Big Endothelin-1 (porcine),CAS : 120796-99-8
Big Endothelin-1 (porcine)
| Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
|---|---|---|---|---|
| R-M-837 | 0.5mg | 550.00 | + Add to cart |
|
| R-M-837 | 1mg | 930.00 | + Add to cart |
|
|
|
||||
Product description
The big endothelins comprise residues 53-90 (human big ET-1) and 53-91 (porcine big ET-1) of the endothelin precursor (preproendothelin). Compared to the mature endothelin-1 (ET-1), both peptides show less vasoconstrictor activity in vitro, but similar pressor effects in vivo.
| Appearance | N/A |
|---|---|
| Molecular weight | N/A |
| Purity | >90% |
| Solubility | N/A |
| Cas | 120796-99-8 |
| Sequence | CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS |
| Synonyms | Big Endothelin-1 (1-39), porcine, Big ET-1 (1-39) (porcine) |
| Molecular Formula | C₁₉₃H₂₈₉N₄₉O₅₈S₅ |
| Storage | -20℃, protected from light and moisture |
| Transportation | 4-25℃ temperature for up to 3 weeks |
| Stability | 1 year |
Document
Related Product

Items-$0.00

Email:
Tel.:
msds of Big Endothelin-1 (porcine)
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


