Big Endothelin-1 (porcine),CAS : 120796-99-8
Big Endothelin-1 (porcine)
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-837 | 0.5mg | 550.00 | + Add to cart |
|
R-M-837 | 1mg | 930.00 | + Add to cart |
|
|
Product description
The big endothelins comprise residues 53-90 (human big ET-1) and 53-91 (porcine big ET-1) of the endothelin precursor (preproendothelin). Compared to the mature endothelin-1 (ET-1), both peptides show less vasoconstrictor activity in vitro, but similar pressor effects in vivo.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 120796-99-8 |
Sequence | CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS |
Synonyms | Big Endothelin-1 (1-39), porcine, Big ET-1 (1-39) (porcine) |
Molecular Formula | C₁₉₃H₂₈₉N₄₉O₅₈S₅ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product