Adrenomedullin (rat) trifluoroacetate salt

H-Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ trifluoroacetate salt (Disulfide bond)

Product description

Adrenomedullin (rat) trifluoroacetate salt,CAS :161383-47-7 from ruixi.Synthetic rat adrenomedullin (rADM) elicits a potent and longlasting hypotensive activity in anesthesized rats.

Appearance	N/A
Molecular weight	N/A
Purity	>95%
Solubility	N/A
Cas	161383-47-7
Sequence	YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH₂
Synonyms	Adrenomedullin (1-50), rat, ADM (1-50) (rat)
Molecular Formula	C₂₄₂H₃₈₁N₇₇O₇₅S₅
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document

MSDS of Adrenomedullin (rat) trifluoroacetate salt

Related Product

• adrenomedullin-13-52-human