Adrenomedullin (13-52) (human)
H-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ (Disulfide bond)
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-612 | 0.5mg | 360.00 | + Add to cart |
|
R-M-612 | 1mg | 640.00 | + Add to cart |
|
|
Product description
Adrenomedullin (13-52) (human),CAS :154765-05-6 from ruixi.hADM (13-52) has endothelium-dependent vasodilation in rat pulmonary vascular bed. In addition, the compound can be used as a regulator of inflammatory vascular phase.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >95% |
Solubility | N/A |
Cas | 154765-05-6 |
Sequence | SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH₂ |
Molecular Formula | C₂₀₀H₃₀₈N₅₈O₅₉S₂ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product