Adrenomedullin (porcine) trifluoroacetate salt
H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ trifluoroacetate salt (Disulfide bond)
Product description
Adrenomedullin (porcine) trifluoroacetate salt,CAS: 912862-96-5 from ruixi.Among ,adrenomedullin (ADM) is an active peptide . Studies have shown that ADM has many physiological effects such as dilating blood vessels, lowering blood pressure and diuresis. In addition, during embryogenesis, ADM is involved in cell proliferation, migration, differentiation, and regulates certain hormone release. The human ADM gene is located on chromosome 11 and contains 4 exons and 3 introns. It consists of 52 amino acids. The amino acid sequence of ADM is highly conserved, and ADM is considered to be a member of the calcitonin gene-related peptide (CGRP) family because its structure has certain homology with calcitonin, CGRP and amylin-like peptide.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >95% |
Solubility | N/A |
Cas | 912862-96-5 |
Sequence | YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH₂ |
Synonyms | Adrenomedullin (1-52), porcine, ADM (porcine) |
Molecular Formula | C₂₆₂H₄₀₃N₇₉O₇₆S₃ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product