X
Email:
sales@ruixibiotech.com

Adrenomedullin 5 (primate) trifluoroacetate salt

H-His-Gln-Val-Pro-Gln-His-Arg-Gly-His-Val-Cys-Tyr-Leu-Gly-Val-Cys-Arg-Thr-His-Arg-Leu-Ala-Glu-Ile-Ile-Gln-Trp-Ile-Arg-Ser-Ala-Ser-Thr-Lys-Glu-Pro-Thr-Gly-Lys-Ala-Ser-Arg-Glu-Pro-Gln-Asn-Pro-Tyr-Ser-Tyr-NH₂ trifluoroacetate salt (Disulfide bond)

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-616 0.5mg 545.00
- +
+ Add to cart

Product description

Adrenomedullin 5 (primate) trifluoroacetate salt,CAS :1816939-48-6 from ruixi.Adrenomedullin 5 (AM5) stimulates central and peripheral cardiovascular actions in mammals. The peptide induced dose-dependent decreases in arterial pressure without affecting the heart rate, when injected intravenously. When injected into the cerebral ventricle, ADM5 increased arterial pressure and heart rate.


Appearance N/A
Molecular weight N/A
Purity >95%
Solubility N/A
Cas 1816939-48-6
Sequence  HQVPQHRGHVCYLGVCRTHRLAEIIQWIRSASTKEPTGKASREPQNPYSY-NH₂
Synonyms AM5 (primate)
Molecular Formula  C₂₅₃H₃₉₄N₈₂O₇₁S₂
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product