Adrenomedullin (11-50), rat,CAS:163648-32-6
Adrenomedullin (11-50), rat
Product description
C-terminal fragment found to induce dose-dependent and endothelium-independent vasodilatation on arterial mesenteric vasculator, though inactive on the venous side of tested rat perfused mesentric bed. This peptide thus shares similar properties to those of CGRP (human).
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 163648-32-6 |
Sequence | H-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt) (Cys4 and 9 bridge) |
One letter sequence | STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Cys4 and 9 bridge) |
Molecular formula | C194H304N58O59S4 |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product