| Catalog | name | Description | price |
|---|---|---|---|
| R-M2-10071 | (DOTA-PEG10K)*2-Lys-MAL | (DOTA-PEG10K)*2-Lys-MAL is a dual-chelator, PEGylated lysine–maleimide conjugate designed for radiolabeling, bioconjugation, and nanoparticle or protein surface functionalization. Applications: Dual-chelator radiopharmaceutical precursor; Theranostic imaging agent platform; Site-specific labeling of antibodies, peptides, or nanoparticles; Construction of high-payload radiolabeled nanocarriers; PEG-based drug delivery systems requiring surface thiol coupling. | price> |
| R-M2-10076 | DMG-PEG2K-EHLHCLGSLCWP | DMG-PEG2K-EHLHCLGSLCWP is a peptide conjugate designed for targeted delivery applications, combining a membrane-anchoring lipid, a hydrophilic PEG spacer, and a functional 12-mer peptide. | price> |
| R-M2-10078 | Chol-PEG2K-KWMIFNGGAPNCIPC | Cholesterol-PEG2K-KWMIFNGGAPNCIPC is a peptide conjugate designed for targeted nanoparticle and liposomal surface functionalization. It combines a cholesterol anchor, a hydrophilic PEG2K chain, and a bioactive 12-mer peptide. Applications: Targeted liposomal drug delivery; Receptor-mediated nanoparticle uptake; Peptide-functionalized lipid nanoparticles (LNPs); Surface engineering for biomaterials and biosensing; Tumor-targeting or stimulus-responsive delivery systems. | price> |
| R-M2-10092 | CYTIWMPENPRPGTPCDIFTNSRGKRASNG-peg-DMG | The core sequence of CYTIWMPENPRPGTPCDIFTNSRGKRASNG peg DMG is derived from the rabies virus glycoprotein (RVG29) and has the ability to penetrate the blood-brain barrier (BBB). PEGylation can enhance its water solubility and stability, while DMG modification may be used to improve drug delivery properties or bind to specific targets. This peptide is mainly used for targeted therapy of brain diseases, such as drug delivery for neurodegenerative diseases or brain tumors. | price> |
| R-M2-10093 | Chol-peg-CYTIWMPENPRPGTPCDIFTNSRGKRASNG | Cholesterol-peg-CYTIWMPENPRPGTPCDIFTNSRGKRASNG/Chol-PEG-CYTIWMPENPGTCDIFTNSRGKRASNG is a brain targeted drug delivery system based on RVG29 peptide. This modification scheme is commonly used in delivery systems such as nanoparticles and liposomes, and is suitable for the treatment of gliomas and neurodegenerative diseases. | price> |
| R-M2-10096 | Chol-PEG2K-RVG29-FAM | Chol-PEG2K-RVG29-FAM/Cholesterol-PEG2K-RVG29-FAM/Cholesterol-PEG2000-RVG29-FAM is mainly used for the construction of nanomedicine delivery systems, achieving drug or fluorescent marker enrichment in specific cells or tissues through targeted action of RVG29 peptide. | price> |
| R-M1-8465 | mPEG2000-CPP10 | CPP10 (Cell Penetrating Peptide 10) is a specific peptide sequence that is used as a cell-penetrating peptide in various biomedical and biotechnological applications. The CPP10 peptide is derived from the transactivator of transcription (Tat) protein of the human immunodeficiency virus (HIV), and consists of a sequence of 11 amino acids (YGRKKRRQRRR). The CPP10 peptide has a unique structure that enables it to efficiently cross the plasma membrane of cells, allowing it to deliver cargo molecules such as drugs, nucleic acids, or proteins to the intracellular environment. | price> |
| R-M2-10104 | DMG-PEG-CKKEEEKKEEEKKEEEK | DMG-PEG-CKKEEEKKEEEKKEEEK is a bifunctional PEG derivative. It is designed for surface functionalization of lipid based nanocarriers. | price> |
| R-M2-10105 | Chol-PEG-CKKEEEKKEEEKKEEEK | Cholesterol-PEG-CKKEEEKKEEEKKEEEK is a complex that binds cholesterol (Chol), polyethylene glycol (PEG), and kidney targeted peptide (KTP), mainly used for kidney targeted drug delivery. Its core function is to specifically bind to renal tubular epithelial cells through the negatively charged amino acid sequence of KTP peptide, actively guide nano drugs, liposomes and other carriers to the kidney, increase the accumulation of drugs in renal tissue and reduce the distribution of non target organs. | price> |
| R-M2-10106 | FITC-SS31 | FITC-SS31 is a fluorescein labeled derivative of SS-31 peptide, specifically designed for mitochondrial targeting studies. Advantages: Non membrane potential dependent targeting, does not affect mitochondrial function measurement, suitable for live cells and in vivo experiments. Application scenarios: Observation of mitochondrial dynamics (such as targeted changes under stress). Efficacy evaluation of oxidative stress models (such as H ₂ O ₂, t-BHP treatment). Mechanism research on mitochondrial related diseases such as sepsis and neurodegenerative diseases. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


