Product peptide-cell-permeable-peptides

Home > products > peptide> cell-permeable-peptides

Catalog	name	Description	price
R-M-1397	DDR1 Peptide	DDR1 is involved in cell-cell interactions and recognition.	price>
R-M-1725	p53 Activator, Cell-Permeable	p53 Activator, Cell-Permeable is a cell-permeable peptide that binds mutant p53.	price>
R-M-1738	L-JNKI-1	L-JNKI-1 is a cell-permeable peptide inhibitor specific for JNK.	price>
R-M-1753	Biotin-TAT (47-57),CAS:1231898-25-1	Biotin-Tat (47-57) is a cell penetrating cationic peptide derived from the N-terminus of the Tat protein found in the human immunodeficiency virus (HIV). It contains a covalently bonded N-terminal Biotin tag.	price>
R-M-1820	Pep2m, myristoylated TFA	Pep2m, myristoylated TFA (Myr-Pep2m TFA) is a cell-permeable peptide. Pep2m, myristoylated TFA can disrupt the protein kinase ζ (PKMζ) downstream targets, N-ethylmaleimide-sensitive factor/glutamate receptor subunit 2 (NSF/GluR2) interactions. PKMζ is an autonomously active isozyme of protein kinase C (PKC).	price>
R-M-1839	HIV-1 TAT (48-60)	HIV-1 TAT (48-60) is a cell-penetrating peptide derived from the human immunodeficient virus (HIV)-1 Tat protein residue 48-60. It has been used to deliver exogenous macromolecules into cells in a non-disruptive way.	price>
R-M-1886	Peptide C105Y,cas:247572-63-0	Peptide C105Y, a synthetic and cell-penetrating peptide based on the amino acid sequence corresponding to residues 359-374 of α1-antitrypsin, enhances gene expression from DNA nanoparticles.	price>
R-M-5095	Bonemarrow-Derived Mesenchymal Stem Cells Affinity Peptide,cas:683750-83-6	Bonemarrow-Derived Mesenchymal Stem Cells Affinity Peptide,Cas:683750-83-6 from ruixi.The heptapeptide EPLQLKM (E7) binds to graphene with high specificity.Additionally, the peptide shows a high affinity for bone marrow stromal cells.	price>
R-M1-8355	pHLIP	PH low insertion peptide (pHLIP) is a cell penetrating peptide (CPP) with pH dependent transmembrane ability.	price>
R-M1-8615	TAT-HA2 Fusion Peptide,cas:923954-79-4	TAT-HA2 Fusion Peptide/Trans-Activator of Transcription (TAT)-HA2 Fusion Peptide/RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG/H-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly-OH is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide induces the cellular uptake of macromolecules into endosomes via the TAT moiety and to respond to the acidifying lumen of endosomes to cause membrane leakage and release of macromolecules into cells via the HA2 moiety.	price>

...