Home > Keywords >
Catalog | name | Description | price |
---|---|---|---|
R-M1-8866 | 5-TTTTTTTT-TTAGGGCATGCACTAC-FITC-3 | This type of DNA sequence is commonly used for molecular biology and genetic research purposes, such as in fluorescence in situ hybridization (FISH) or other fluorescent labeling assays. In this case, the FITC molecule allows for the visualization and detection of the DNA sequence within a biological sample or experimental assay, as FITC emits green fluorescence when excited by appropriate light.The DNA sequence itself, "GGGCATGCACTAC," could potentially serve as a probe for targeting complementary sequences or specific genetic regions in research applications, while the presence of the FITC label enables visualization and tracking of the labeled DNA sequence within a biological context. | price> |
R-M-5414 | 5(6)-TRITC | 5(6)-TRITC,Tetramethylrhodamine isothiocyanate, 5 and 6 isomers from ruixi.5(6)-TRITC is an isocyanate of tetramethylrhodamine (Tamra), which can be used to label amino functional groups. Compared with NHS activated ester, isocyanate is more stable, but the reaction activity is lower than NHS activated ester. | price> |
R-M1-8867 | CIKNRDGCQPDGSQGNCCSGYCHKEPGWVAGYCR | This sequence(CIKNRDGCQPDGSQGNCCSGYCHKEPGWVAGYCR) represents a linear chain of amino acids that would fold and interact with other molecules to form the functional three-dimensional structure of a protein or peptide. The specific function or properties of the protein or peptide corresponding to this sequence would depend on its overall structure, interactions with other molecules, and cellular context. | price> |
R-M-5415 | ROX NHS ester, 5 and 6 isomers | ROX NHS ester, 5 and 6 isomers,Rhodamine X NHS ester , 5 and 6 isomers from ruixi.Rox, also known as rhodamine 101, is the abbreviation of rhodamine x (or x-rhodamine). X in the name indicates that rhodamine amino group is replaced by cyclization. In the field of fluorescent dyes, Rox often refers to Rox derivatives with 5 / 6 carboxylic acid structure, which can be used for the activation and labeling of fluorescent dyes. Rox is a fluorescent dye commonly used in the laboratory. It has good fat solubility and poor water solubility. It is often used as a fluorescent reporter of biological probes that need membrane penetration NHS activated ester (N-hydroxysuccinimide ester, successful ester, Se) is the most commonly used activated group in biomarker reaction. NHS activates the carboxyl group in the dye molecule, so that it can react with the amine group (main primary amine) on the target biological molecule to form a stable amide bond, so as to label the dye molecule on the biological macromolecule. | price> |
R-M1-8868 | NH2-PEG1000-HKNKGKKNGKHNGWK | NH2-PEG1000-HKNKGKKNGKHNGWK could be utilized for various purposes such as drug delivery, biotechnology applications, or as a targeting ligand. The presence of the PEG linker can help enhance the solubility and stability of the peptide and potentially modulate its pharmacokinetic properties. | price> |
R-M-5416 | Rhodamine X carboxylic acid | Rox, also known as rhodamine 101, is the abbreviation of rhodamine x (or x-rhodamine). X in the name indicates that rhodamine amino group is replaced by cyclization. In the field of fluorescent dyes, Rox often refers to Rox derivatives with 5 / 6 carboxylic acid structure, which can be used for the activation and labeling of fluorescent dyes. Rox is a fluorescent dye commonly used in the laboratory. It has good fat solubility and poor water solubility. It is often used as a fluorescent reporter of biological probes that need to penetrate the membrane. The product is Rox carboxylic acid, and the functional groups are not activated. Therefore, the labeled dye will not react with any functional groups and is very stable in organic solvents or aqueous solvents. | price> |
R-M1-ct8869 | EBNAl562-570:FMVFLQTHI | The notation "EBNA1 562-570:FMVFLQTHI" represents a specific sequence derived from the Epstein-Barr virus nuclear antigen 1 (EBNA1). The sequence "FMVFLQTHI" corresponds to amino acids 562 to 570 of the EBNA1 protein.Epstein-Barr virus (EBV) is a member of the herpesvirus family and is known to cause infectious mononucleosis (glandular fever). The EBNA1 protein is expressed during latent infection and is involved in maintaining the viral genome in latently infected cells. | price> |
R-M-5417 | ROX amine | Rox, also known as rhodamine 101, is the abbreviation of rhodamine x (or x-rhodamine). X in the name indicates that rhodamine amino group is replaced by cyclization. Rox is a fluorescent dye commonly used in the laboratory. It has good fat solubility and poor water solubility. It is often used as a fluorescent reporter of biological probes that need membrane penetration (Rox amine) the product contains amino functional groups and can react with functional groups such as carboxylic acid. 6 carbon short chain helps to separate dye molecules from labeled objects, improve labeling efficiency and reduce the impact of labeled objects on dye molecules. | price> |
R-M1-8870 | LMP2A426-434:CLGGLLTMV | The notation "LMP2A426-434:CLGGLLTMV" represents a specific sequence derived from the Epstein-Barr virus (EBV) latent membrane protein 2A (LMP2A). The sequence "CLGGLLTMV" corresponds to amino acids 426 to 434 of the LMP2A protein.LMP2A is a protein encoded by EBV that has been implicated in viral latency and immune evasion. Sequence notations like "LMP2A426-434:CLGGLLTMV" are commonly used in the context of immunological research and vaccine development. This sequence may serve as an epitope or antigenic determinant for immune responses and could be a target for studying the interactions of the EBV virus with the immune system. | price> |
R-M-5418 | X-Rhodamine maleimide | Rox, also known as rhodamine 101, is the abbreviation of rhodamine x (or x-rhodamine). X in the name indicates that rhodamine amino group is replaced by cyclization. Rox is a fluorescent dye commonly used in the laboratory. It has good fat solubility and poor water solubility. It is often used as a fluorescent reporter of biological probes that need membrane penetration (x-rhodamine maleimide) the active group of the product is maleimide. Maleimide is a group commonly used in biomarker reaction. It can generate stable thioether structure through affinity addition reaction with sulfhydryl (- SH), so as to realize labeling. | price> |
R-C-4753 | DSPE-PEG-cRGD-FITC | Pegylated phospholipids are excellent liposome formation materials that can be used for drug delivery, gene transfection and vaccine delivery as well. Pegylation of phospholipids significantly improves the blood circulation time and stability for encapsulated drugs. Fluorescein labeled DSPE PEG products emitted green fluorescence and can be easily detected with fluorescent microscopy or spectroscopy.cRGD is an active target material,It can be used as an antitumor drug carrier and active targeted delivery. | price> |
R-M1-cs8871 | Human serum albumin nanoparticles@lidocaine | Human serum albumin is a commonly used carrier molecule for drug delivery due to its biocompatibility and ability to encapsulate or bind with various drugs. When combined with lidocaine, it forms nanoparticles wherein the drug is likely encapsulated or conjugated to the surface of the HSA nanoparticles. The use of HSA nanoparticles as a carrier for lidocaine can have several potential benefits for drug delivery, including improved solubility, controlled release, targeted delivery, and reduced toxicity. These nanoparticles can enhance the pharmacokinetic profile and tissue distribution of lidocaine, potentially improving the effectiveness of the drug for various therapeutic applications. | price> |
R-M-5419 | Rhodamine Red-maleimide | Rhodamine red, also known as sulfonated rhodamine B, and lissamine rhodamine B (LRB), is a sulfonated substituted rhodamine B. Its excitation and emission peaks are 570 nm and 590 nm, respectively. The emission spectrum is between tetramethylrhodamine and Texas Red. It is a common fluorescent dye. Similar to Dezhou red, rhodamine red has its own sulfonate ion, which has good water solubility and is conducive to biomarker Maleimide is a group commonly used in biomarker reaction. It can generate stable thioether structure through affinity addition reaction with sulfhydryl (- SH), so as to realize labeling. Although amino groups (such as lysine arginine side chain) also have affinity, maleimide selectively labels sulfhydryl groups in neutral or slightly acidic buffer (reaction speed > 1000 times faster than amino groups). The labeling reaction has the advantages of rapid reaction, high selectivity and good yield. In addition, sulfhydryl is a functional group widely existing in biomolecules, such as serine and disulfide bond in proteins. Therefore, maleimide / thiol labeling has become the most commonly used biological ligation reaction second only to NHS / amino labeling. | price> |
R-C-4754 | DSPE-PEG-peptide(PPGAYHGA) | The polyethylene glycol copolymer with biodegradable and biocompatible polyester chain segments can also be used to prepare core-shell micelles, nanoparticles and microspheres.The active group at the end of the product can link some modified peptides,proteins,carbohydrates,folic acid or antibodies to make them have active targeting effect. | price> |
R-M1-cs8872 | Human blood albumin nanoparticles@bulleyaconitine A (100nm) | Human blood albumin nanoparticles coated with bulleyaconitine A (100nm)" represents a drug delivery system wherein human blood albumin nanoparticles are employed to deliver bulleyaconitine A, and the size of the resulting nanoparticles is around 100 nanometers. This approach may hold promise for the development of more effective and targeted therapies for conditions amenable to bulleyaconitine A treatment. | price> |
R-M-5420 | Rhodamine Red-amine | Rhodamine red, also known as sulfonated rhodamine B, and lissamine rhodamine B (LRB), is a sulfonated substituted rhodamine B. Its excitation and emission peaks are 570 nm and 590 nm, respectively. The emission spectrum is between tetramethylrhodamine and Texas Red. It is a common fluorescent dye. Similar to Dezhou red, rhodamine red has its own sulfonate ion, which has good water solubility and is conducive to biomarker (rhodamine red amine) the product contains amino functional groups and can react with functional groups such as carboxylic acid. 6 carbon short chain helps to separate dye molecules from labeled objects, improve labeling efficiency and reduce the impact of labeled objects on dye molecules. | price> |
R-C-4755 | DSPE-polyethylene-glycol350-peptide(PPGAYHGA) | The polyethylene glycol copolymer with biodegradable and biocompatible polyester chain segments can also be used to prepare core-shell micelles,nanoparticles and microspheres.The active group at the end of the product can link some modified peptides,proteins,carbohydrates,folic acid or antibodies to make them have active targeting effect. | price> |
R-M1-8873 | FITC-LIGLYLLHRRRRRHC-DOX | FITC-LIGLYLLHRRRRRHC-DOX/ FITC-LIGLYLLHRRRRRHC-Doxorubicin represents a molecular construct where a fluorescent dye, a peptide sequence, and a chemotherapeutic agent are linked together, potentially for research purposes in drug delivery and imaging, particularly related to cancer therapy. | price> |
R-M-5421 | Texas Red NHS ester | Texas Red NHS ester,Sulforhodamine 101, nhs from ruixi.Texas Red, also known as sulfonated rhodamine 101, is a traditional but still commonly used red fluorescent dye. The main excitation peak of Texas Red dye is 589 nm, and it can also be excited by krypton laser at about 567 nm. The excitation efficiency is slightly lower. The fluorescence emission peak of Dezhou red is about 615 nm, which belongs to the visible area of human flesh eye and is more sensitive. Dezhou red molecule has sulfonate ion, good water solubility and bright fluorescence. It can be used to develop antigens with very low expression NHS activated ester (N-hydroxysuccinimide ester, successful ester, Se) is the most commonly used activated group in biomarker reaction. NHS activates the carboxyl group in the dye molecule, so that it can react with the amine group (main primary amine) on the target biological molecule to form a stable amide bond, so as to label the dye molecule on the biological macromolecule. | price> |
R-C-4756 | peptide(PPGAYHGA)-PEG550-DSPE | The polyethylene glycol copolymer with biodegradable and biocompatible polyester chain segments can also be used to prepare core-shell micelles, nanoparticles and microspheres.The active group at the end of the product can link some modified peptides,proteins,carbohydrates,folic acid or antibodies to make them have active targeting effect. | price> |