Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-C-4625	β- Hydroxybutyric acid (GHBA)-Fe3O4（20-50nm）	β- Hydroxybutyric acid (GHBA) is an important component of ketone bodies in blood waves. BHBA is used by the brain as a source of energy, especially under the conditions of assisted lactation neonates and infants. It is inferred that as a further signal substance, it regulates energy center and acts as biological oxidation base to co regulate food intake.	price>
R-M-5291	NH2-CBAA-PEG350-MAL	Amine-Betaine carboxylate acrylamide-Polyethylene glycol-Maleimide，NH2-CBAA-PEG-MAL from ruixi.Ruixi is a biotechnology company. Our company focuses on the production and sales of scientific research level drug delivery and drug nano targeting products. At present, our products mainly include synthetic phospholipids, PEG derivatives, block copolymers, nano gold, magnetic nanoparticles, mesoporous silica, reactive fluorescent dyes, fluorescent quantum dots, click chemistry and macrocyclic ligands.	price>
R-C-4626	4-Arm PEG-PCL, PEG 10k PCL 10k	4-Arm PEG-PCL has one PCL block on each of the four PEG arms. The MW of PEG or PCL refers to the total MW of all four arms. PEG-PCL is an AB diblock copolymer consisting of a hydrophilic block polyethylene glycol (PEG) and a hydrophobic block polycaprolactone (PCL).	price>
R-M-5292	amine-CBAA-PEG550-MAL	Amine-Betaine carboxylate acrylamide-Polyethylene glycol-Maleimide，NH2-CBAA-PEG-MAL from ruixi.Ruixi is a biotechnology company. Our company focuses on the production and sales of scientific research level drug delivery and drug nano targeting products. At present, our products mainly include synthetic phospholipids, PEG derivatives, block copolymers, nano gold, magnetic nanoparticles, mesoporous silica, reactive fluorescent dyes, fluorescent quantum dots, click chemistry and macrocyclic ligands.	price>
R-C-4627	8-Arm PEG-PCL, PEG 20k & PCL 10k	8-Arm PEG-PCL has one PCL block on each of the eight PEG arms. The MW of PEG or PCL refers to the total MW of all eight arms. PEG-PCL is an AB diblock copolymer consisting of a hydrophilic block polyethylene glycol (PEG) and a hydrophobic block polycaprolactone (PCL).	price>
R-M-5293	MAL-arboxybetaine acrylamide-PEG750-Amine	Amine-Betaine carboxylate acrylamide-Polyethylene glycol-Maleimide，NH2-CBAA-PEG-MAL from ruixi.Ruixi is a biotechnology company. Our company focuses on the production and sales of scientific research level drug delivery and drug nano targeting products. At present, our products mainly include synthetic phospholipids, PEG derivatives, block copolymers, nano gold, magnetic nanoparticles, mesoporous silica, reactive fluorescent dyes, fluorescent quantum dots, click chemistry and macrocyclic ligands.	price>
R-C-4628	Acrylate-PCL(200)-PEG(300)-PCL(200)-Acrylate	Acrylate-PCL-PEG-PCL-Acrylate is a triblock copolymer with two terminal acrylate groups. The molecular weight of each block is shown in the parenthesis following the name of the block.PCL-PEG-PCL functionalized with acrylate is to prepare biodegradable PEG hydrogels through photopolymerization.Other functionalized PCL-PEG-PCL derivatives with reactive groups at the two terminals of the copolymer may be offered through custom synthesis.	price>
R-M-5294	NH2-CBAA-PEG350-SH	Amine-Betaine carboxylate acrylamide-Polyethyleneglycol-Thiol,NH2-CBAA-PEG-SH from ruixi.Ruixi is a biotechnology company. Our company focuses onthe production and sales of scientific research level drug delivery and drugnano targeting products. At present, our products mainly include syntheticphospholipids, PEG derivatives, block copolymers, nano gold, magneticnanoparticles, mesoporous silica, reactive fluorescent dyes, fluorescentquantum dots, click chemistry and macrocyclic ligands.	price>
R-C-4629	PEI-PEG-PEI	Copolymers of cationic poly(ethylene imine) (PEI) and polyethylene glycol (PEG) markedly improve in vitro and in vivo delivery of oligonucleotides and nucleic acids (DNA, siRNA). LPEI-b-PEG-b-LPEI can have varying MW of PEI and MW of PEG. PEG-PEI drug conjugates,polyplexes or nanoparticles can be prepared with a dynamic range of size,surface charge, and stability. Properties important to transfection efficiency.	price>
R-M-5295	Thiol-CBAA-PEG550-Amine	Amine-Betaine carboxylate acrylamide-Polyethyleneglycol-Thiol,NH2-CBAA-PEG-SH from ruixi.Ruixi is a biotechnology company. Our company focuses onthe production and sales of scientific research level drug delivery and drugnano targeting products. At present, our products mainly include syntheticphospholipids, PEG derivatives, block copolymers, nano gold, magneticnanoparticles, mesoporous silica, reactive fluorescent dyes, fluorescentquantum dots, click chemistry and macrocyclic ligands.	price>
R-C-4630	Citrate-stabilized Fe3O4 nanoparticles Fe3O4 Size:20nm	(citrate-stabilized) Fe3O4 aqueous colloidal magnetic nanoparticles (CA-MNP) of size 8–10 nm using soft chemical route.The surface functionalization of Fe3O4 nanoparticles with citric acid was evident from infrared spectroscopy, thermal and elemental analyses, and zeta-potential measurements.	price>
R-M-5296	SH-CBAA-PEG750-Amine	Amine-Betaine carboxylate acrylamide-Polyethyleneglycol-Thiol,NH2-CBAA-PEG-SH from ruixi.Ruixi is a biotechnology company. Our company focuses onthe production and sales of scientific research level drug delivery and drugnano targeting products. At present, our products mainly include syntheticphospholipids, PEG derivatives, block copolymers, nano gold, magneticnanoparticles, mesoporous silica, reactive fluorescent dyes, fluorescentquantum dots, click chemistry and macrocyclic ligands.	price>
R-C-4631	DSPE-PEG4-DBCO	DSPE-PEG4-DBCO is a PEG linker containing DSPE and DBCO moieties. The DSPE-PEGs have been FDA approved for medical applications. The hydrophobic properties of the DSPE allow for the encapsulation and congregation of other hydrophobic drugs. The hydrophilic PEG linker increases the water solubility of the overall compound allowing for the delivery of the drug. The DBCO group can be used for copper-free Click Chemistry reactions. Reagent grade, for research use only.	price>
R-C-4632	DSPE-PEG8-Mal	The hydrophobic properties of the DSPE allow for the encapsulation and congregation of other hydrophobic drugs. The hydrophilic PEG linker increases the water solubility of the overall compound allowing for the delivery of the drug. Maleimide groups can react with thiols between pH 6.5 to 7.5.	price>
R-M-5298	BDP R6G hydrazide	BDP R6G is a borondipyrromethene dye whose absorption and emission spectra resemble those of R6G (rhodamine 6G). This hydrazide is a carbonyl-reactive compound that is useful for the labeling of aldehydes, ketones, and most carbohydrates (oxidized with periodate).	price>
R-C-4633	DSPE-PEG12-Mal	DSPE-PEG12-Mal is a PEG linker containing DSPE and maleimide moieties. The hydrophobic properties of the DSPE allow for the encapsulation and congregation of other hydrophobic drugs. The maleimide group will react with a thiol group to form a covalent bond, enabling the connection of biomolecule with a thiol. The hydrophilic PEG linker increases the water solubility of the overall compound allowing for the delivery of the drug.	price>
R-M1-8751	NH2-PEG3-Biotin	Amine-peg3-Biotin/Biotin-peg3-Amine/Biotin-peg3-NH2/NH2-PEG3-Biotin provides a versatile tool for biotin-mediated binding and immobilization in various biological or analytical applications.	price>
R-M-5299	BDP R6G tetrazine	BDP R6G is a borondipyrromethene dye that has absorption and emission wavelengths close to rhodamine 6G (R6G). BDP R6G is a very bright and photostable dye.Tetrazine fragment is used in inverse electron demand Diels Alder reaction with trans-cyclooctenes, acylazetines, and other strained olefins.	price>
R-C-4634	DSPE-PEG-Iodoacetyl	DSPE-PEG-Iodoacetyl , MW 2,000 is a thiol reactive phospholipid polyPEG. The iodoacetyll group is reactive with thiol to produce a thioether linkage. The polymer can self-assemble in water to form lipid bilayer and can be used to encapsulate drugs in targeted delivery application, such as liposomal doxorubicin as an anti cancer drug or mRNA vaccine.	price>
R-M1-8752	TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR	TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECATSLNPDYREEDTDVR is a peptide sequence that can be used for drug delivery and targeted research.	price>

887888889890891892 893894895896897