Home > Keywords > 
Catalog name Description price
R-C-4251 Glycyrrhetinic acid-PEG750-DSPE DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.It is a long circulating liposome membrane,formation of micelles in water dispersion,the critical micelle concentration(CMC)ratio of surfactant is 102 times lower,so the drug stability is better,even by hemodilution, can maintain the integrity of the micelle particle,has certain targeting,easy accumulation in solid tumors. Glycyrrhetinic acid is a pentacyclic triterpenoid substance,which is obtained from glycyrrhizic acid hydrolysis of Glycyrrhiza glabra.Glycyrrhetinic acid can be regarded as β-A derivative of oleanol,thereby serving as a glycosidic ligand of glycyrrhizic acid. price>
R-M-1745 GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. price>
R-M-4016 HBC620,cas: 2530162-07-1 HBC620 is a non fluorescent HBC simulant. HBC is non fluorescent in solution, but it will emit strong fluorescence when forming a close complex with pepper RNA aptamer. HBC pepper complex can be used to observe the dynamic changes of RNA in living cells. price>
R-C-4252 DSPE-PEG350-CGP DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.The most important role of choline glycerophosphatide is that the chemicalbook choline produced by GPC is a water-soluble vitamin B family,which plays an important role in the brain and nervous system.Studies have shown that GPC plays an important role in the production of certain hormones and neurotransmitters such as acetylcholine and human growth hormone,thus supporting the functions of the brain and nervous system. price>
R-M-1746 TFLLR-NH2(TFA),CAS:1313730-19-6 TFLLR-NH2 (TFA) is a selective PAR1 agonist with an EC50 of 1.9 μM. price>
R-M-4017 9-Aminoacridine,cas:90-45-9 9-Aminoacridine (Aminacrine) is a highly fluorescent dye used as a topical antiseptic and experimentally as a mutagen, an intracellular pH indicator. 9-Aminoacridine is an effective antibacterial agent with caries-disclosing features. price>
R-C-4253 DSPE-polyethylene glycol550-CGP DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.The most important role of choline glycerophosphatide is that the chemicalbook choline produced by GPC is a water-soluble vitamin B family,which plays an important role in the brain and nervous system.Studies have shown that GPC plays an important role in the production of certain hormones and neurotransmitters such as acetylcholine and human growth hormone,thus supporting the functions of the brain and nervous system. price>
R-M-1747 NLS (PKKKRKV) hydrochloride NLS (PKKKRKV) hydrochloride is a nuclear localization signal (NLS) derived from the simian virus 40 large tumor antigen (SV40 large T antigen). NLS (PKKKRKV) can function as a method to enhance nuclear entry in the field of gene transfer research. price>
R-M-4018 1,3-Diphenylisobenzofuran,cas:5471-63-6  1,3-Diphenylisobenzofuran (DPBF) is a fluorescent probe which possesses a highly specific reactivity towards singlet oxygen (1O2) forming an endoperoxide which decomposes to give 1,2-dibenzoylbenzene. 1,3-Diphenylisobenzofuran can detect the generation of reactive oxygen species (ROS). price>
R-C-4254 choline glycerophosphatide-PEG750-DSPE DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.The most important role of choline glycerophosphatide is that the chemicalbook choline produced by GPC is a water-soluble vitamin B family,which plays an important role in the brain and nervous system.Studies have shown that GPC plays an important role in the production of certain hormones and neurotransmitters such as acetylcholine and human growth hormone,thus supporting the functions of the brain and nervous system. price>
R-M-1749 Fmoc-Thr[GalNAc(Ac)3-α-D]-OH, CAS:116783-35-8 price>
R-M-4019 DFHBI-1T,Cas:1539318-36-9 DFHBI-1T is a membrane permeable RNA aptamer activated fluorescent probe (EX / EM = 472 nm / 507 nm). DFHBI-1T binds to RNA aptamers (spike, Spike 2, ispinach, broccoli) and produces specific fluorescence and low background fluorescence. DFHBI-1T can be used for RNA imaging in living cells. price>
R-C-4255 DSPE-PEG350-Glucose Glucose plays an important role in the field of biology. It is the energy source and metabolic intermediate product of living cells, that is, the main energy supply of organisms.DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.Suitable for the development of long circulating liposomes. price>
R-M-1750 T7 Tag Peptide,CAS: 245445-88-9 The T7 tag is an epitope tag composed of an 11-residue peptide encoded from the leader sequence of the T7 bacteriophage gene10. Epitope tags are useful for the labeling and detection of proteins using immunoblotting, immunoprecipitation, and immunostaining techniques. The T7 tag is commonly engineered onto the N- or C- terminus of a protein of interest so that the tagged protein can be analyzed and visualized using immunochemical methods. The T7 tag has been used extensively as a general epitope tag in many expression vectors including the pET system that is based on T7 RNA polymerase expression systems . price>
R-M-4020 MOF-5 (Zn) Metal organic framework material (MOF) is a new porous material with regular pore size, high specific surface area and large pore volume.MOF-5 (Zn) is one of them. Because of its huge specific surface area, it has broad application prospects in adsorption separation, gas capture and storage. price>
R-C-4256 DSPE-polyethylene glycol550-Glucose Glucose plays an important role in the field of biology. It is the energy source and metabolic intermediate product of living cells, that is, the main energy supply of organisms.DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.Suitable for the development of long circulating liposomes. price>
R-M-1752 S Tag Peptide S Tag Peptide is a 15 amino acid peptide derived from RNase A. price>
R-M-4021 UiO-66 (Zr),cas:1072413-89-8 UiO-66 (Zr),Universitetet i Oslo-66 (Zr)from ruixi.Uio-66 is a typical nano porous metal organic framework (MOF) with high specific surface area and thermal stability. price>
R-C-4257 Glucose-PEG750-DSPE Glucose plays an important role in the field of biology. It is the energy source and metabolic intermediate product of living cells, that is, the main energy supply of organisms.DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.Suitable for the development of long circulating liposomes. price>
R-M-1753 Biotin-TAT (47-57),CAS:1231898-25-1 Biotin-Tat (47-57) is a cell penetrating cationic peptide derived from the N-terminus of the Tat protein found in the human immunodeficiency virus (HIV). It contains a covalently bonded N-terminal Biotin tag. price>