Home > Keywords > 
Catalog name Description price
R-C-4243 DSPE-PEG350-Angiopep 1, 2-Distearoyl-sn-glycero-3-phosphoethanolamine-Poly(ethylene glycol)(DSPE-PEG)is a widely used phospholipids-polymer conjugate in drug delivery applications.It is a biocompatible,biodegradable and amphiphilic material which can also be functionalized with various biomolecules for specific functions.Angiopep-2 (ANG)can target low density lipoprotein receptor associated protein(LRP)on the surface of cerebral capillary endothelial cells (BCECs) and show high BBB transport capacity. price>
R-M-1737 NH2-KLGADTDGEQDQHMTYGGQ-COOH NH2-KLGADTDGEQDQHMTYGGQ-COOH is a synthetic peptide chain with an amine group attached to lysine and an carboxyl group attached to glutamine. price>
R-M-4008 DiD perchlorate,cas:127274-91-3  DiD perchlorate is a far-red fluorescent lipophilic cyanine dye. DiD perchlorate can rapidly and stably integrate into the phospholipid cell membrane. DiD perchlorate is used to cells tracking. price>
R-C-4244 DSPE-polyethylene glycol550-Angiopep 1, 2-Distearoyl-sn-glycero-3-phosphoethanolamine-Poly(ethylene glycol)(DSPE-PEG)is a widely used phospholipids-polymer conjugate in drug delivery applications.It is a biocompatible,biodegradable and amphiphilic material which can also be functionalized with various biomolecules for specific functions.Angiopep-2 (ANG)can target low density lipoprotein receptor associated protein(LRP)on the surface of cerebral capillary endothelial cells(BCECs)and show high BBB transport capacity. price>
R-M-1738 L-JNKI-1 L-JNKI-1 is a cell-permeable peptide inhibitor specific for JNK. price>
R-M-4009 7-Aminoactinomycin D,Cas:7240-37-1 7-Aminoactinomycin D is a fluorescent DNA dye for apoptosis and flow cytomtery studies. price>
R-C-4245 Angiopep-PEG750-DSPE 1, 2-Distearoyl-sn-glycero-3-phosphoethanolamine-Poly(ethylene glycol)(DSPE-PEG)is a widely used phospholipids-polymer conjugate in drug delivery applications.It is a biocompatible,biodegradable and amphiphilic material which can also be functionalized with various biomolecules for specific functions.Angiopep-2 (ANG)can target low density lipoprotein receptor associated protein(LRP)on the surface of cerebral capillary endothelial cells (BCECs) and show high BBB transport capacity. price>
R-M-1739 HAE,CAS : 64111-99-5 HAE is a 3-amino acid peptide which consists of histidine, alanine and glutamate. price>
R-M-4010 DAF-FM DA ,cas:254109-22-3 DAF-FM DA is a reagent to detect and quantify low concentrations of nitric oxide (NO); DAF-FM fluorescence can be detected by any instrument that can detect fluorescein, including flow cytometers, microscopes, fluorescent microplate readers and fluorometers. price>
R-M-1740 [bAla8]-Neurokinin A(4-10) [bAla8]-Neurokinin A(4-10) is a NK2 receptor agonist (pD2 = 6.91). Produces bladder contraction and bronchospasm in guinea pigs in vivo. price>
R-M-4011 FAM NHS ester, 6-isomer Fluorescein (FAM) is a bright fluorophore that has found an extremely wide application in life science research. The fluorophore is hydrophilic and its derivatives possess good solubility in aqueous buffers.Fluorescein is compatible with a wide variety of fluorescent instrumentation - most instruments are equipped with FAM channel filters. price>
R-M-4012 Cy2-SE (iodine),cas:186205-33-4  CY2-SE (Cyanine2 Succinimidyl Ester) is a dye for the labeling of amino-groups in peptides, proteins, and oligonucleotides. Excitation (nm):492, Emission (nm): 510. price>
R-M-1741 c-Myc Peptide Trifluoroacetate c-Myc Peptide Trifluoroacetate is a synthetic peptide corresponding to the C-terminal amino acids (410-419) of human c-myc protein, and participates in regulation of growth-related gene transcription. price>
R-M-4013 CY7-SE triethylamine CY7-SE triethylamine is a fluorescence labeling agent (Ex=700-770 nm, Em=790 nm). Cyanine dyes are used to label proteins, antibodies, peptides, and oligonucleotides. price>
R-M-1742 V5 Epitope Tag Peptide Trifluoroacetate V5 Epitope Tag Peptide Trifluoroacetate is a Tag Peptide derived from a small Epitope on P and V proteins of monkey-virus paramyxovirus. price>
R-C-4249 DSPE-PEG350-Glycyrrhetinic acid DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids. It is a long circulating liposome membrane, formation of micelles in water dispersion, the critical micelle concentration(CMC)ratio of surfactant is 102 times lower, so the drug stability is better, even by hemodilution, can maintain the integrity of the micelle particle,has certain targeting, easy accumulation in solid tumors. Glycyrrhetinic acid is a pentacyclic triterpenoid substance, which is obtained from glycyrrhizic acid hydrolysis of Glycyrrhiza glabra. Glycyrrhetinic acid can be regarded as β- A derivative of oleanol, thereby serving as a glycosidic ligand of glycyrrhizic acid. price>
R-M-4014 L-ANAP hydrochloride L-ANAP hydrochloride is a fluorescent unnatural amino acid used as gene coding and polarity sensitive, which is used in imaging biology research. price>
R-M-1743 Apelin-13 TFA Apelin-13 is the endogenous ligand of the APJ receptor, activating this G protein-coupled receptor with an EC50 value of 0.37 nM. price>
R-C-4250 DSPE-polyethylene glycol550-Glycyrrhetinic acid DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids. It is a long circulating liposome membrane, formation of micelles in water dispersion, the critical micelle concentration(CMC)ratio of surfactant is 102 times lower, so the drug stability is better, even by hemodilution, can maintain the integrity of the micelle particle,has certain targeting, easy accumulation in solid tumors. Glycyrrhetinic acid is a pentacyclic triterpenoid substance, which is obtained from glycyrrhizic acid hydrolysis of Glycyrrhiza glabra. Glycyrrhetinic acid can be regarded as β- A derivative of oleanol, thereby serving as a glycosidic ligand of glycyrrhizic acid. price>
R-M-1744 FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia. price>