Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-R-5131	2,3-Dimethylbenzene-1,4-dicarbonitrile CAS No.:103754-49-0	2,3-Dimethylbenzene-1,4-dicarbonitrile/CAS No.:103754-49-0, a chemical compound, possesses diverse applications in scientific research. Its unique properties make it ideal for synthesizing organic compounds, studying molecular interactions, and developing advanced materials. This versatile compound offers immense potential for innovation and breakthroughs in various scientific fields. Please inquire in advance to purchase this product.	price>
R-M-988	1-Naphthalenylsulfonyl-Ile-Trp-aldehyde	Cell-permeable and reversible inhibitor of cathepsin L, a lysosomal cysteine protease ( IC₅₀ 1.9 nM). 1-Naphthalenylsulfonyl-IW-CHO inhibited the release of Ca²⁺ and hydroxyproline from bone in an in vitro bone culture system. It should be useful for the treatment of osteoporosis.	price>
R-C-3462	MC-DA7R-polyethylene glycol350-DSPE	MC-DA7R-PEG-DSPE liposome delivery system can transport BBB and BBTB, target glioma cells,stem cells and tumor neovascularization.After doxorubicin was loaded,MC-DA7R-PEG-DSPE liposomes could effectively inhibit tumor angiogenesis and pseudo angiogenesis,promote apoptosis of glioma cells,and reduce the number of glioma stem cells,thus enhancing the anti glioma effect of doxorubicin.The median survival time of the model animals was longer than that of single targeted molecular modified liposomes (MC-PEG-DSPE liposome and DA7R-PEG-DSPE liposome) 63.6% and 38.5% respectively.	price>
R-R-5132	4-Hydroxy-2,5,6-trichloroisophthalonitrile CAS No.:28343-61-5	4-Hydroxy-2,5,6-trichloroisophthalonitrile/CAS No.:28343-61-5 is a member of the class of trichlorophenols. It is an isophthalonitrile substituted at positions 2, 4, and 5 by chloro groups and at position 6 by a hydroxy group . It is the major metabolite of chlorothalonil and has a role as a bacterial xenobiotic metabolite . Please inquire in advance to purchase this product.	price>
R-M-989	α-Neoendorphin,CAS : 69671-17-6	A hypothalamic opioid peptide related to Leu-enkephalin and dynorphin A with potent activity in the guinea-pig ileum assay.	price>
R-C-3463	DSPE-PEG550-MC-DA7R	MC-DA7R-PEG-DSPE liposome delivery system can transport BBB and BBTB, target glioma cells,stem cells and tumor neovascularization.After doxorubicin was loaded,MC-DA7R-PEG-DSPE liposomes could effectively inhibit tumor angiogenesis and pseudo angiogenesis,promote apoptosis of glioma cells,and reduce the number of glioma stem cells,thus enhancing the anti glioma effect of doxorubicin.The median survival time of the model animals was longer than that of single targeted molecular modified liposomes (MC-PEG-DSPE liposome and DA7R-PEG-DSPE liposome) 63.6% and 38.5% respectively.	price>
R-R-5133	1,2-Benzenedicarbonitrile, 4,5-dimethyl- CAS No.:36360-43-7	1,2-Benzenedicarbonitrile, 4,5-dimethyl- (BDMD)/CAS No.:36360-43-7 is an organic compound with a wide range of applications in scientific research. BDMD is a versatile compound used in the synthesis of organic compounds, and its properties make it an important tool in laboratory experiments. BDMD has been used in a variety of scientific research applications, including drug development and the study of biological systems. Please inquire in advance to purchase this product.	price>
R-M-990	β-Neoendorphin,CAS : 77739-21-0	A hypothalamic opioid peptide related to Leu-enkephalin and dynorphin A with potent activity in the guinea-pig ileum assay.	price>
R-C-3464	MC-DA7R-PEG750-DSPE	MC-DA7R-PEG-DSPE liposome delivery system can transport BBB and BBTB,target glioma cells,stem cells and tumor neovascularization.After doxorubicin was loaded,MC-DA7R-PEG-DSPE liposomes could effectively inhibit tumor angiogenesis and pseudo angiogenesis,promote apoptosis of glioma cells,and reduce the number of glioma stem cells,thus enhancing the anti glioma effect of doxorubicin.The median survival time of the model animals was longer than that of single targeted molecular modified liposomes (MC-PEG-DSPE liposome and DA7R-PEG-DSPE liposome) 63.6% and 38.5% respectively.	price>
R-R-5134	Thieno[3,2-b]thiophene-2,5-dicarbaldehyde CAS No.:37882-75-0	Thieno[3,2-b]thiophene-2,5-dicarbaldehyde/CAS No.:37882-75-0 is a chemical compound with the empirical formula C8H4O2S2 . It is used as a monomer in the synthesis of Covalent Organic Frameworks (COFs) materials . This molecule has been used in the synthesis of novel metal-free organic dyes for Dye-Sensitized Solar Cells, reaching conversion efficiencies of 6.23% . Please inquire in advance to purchase this product.	price>
R-M-991	Nesfatin-1 (human) trifluoroacetate salt，CAS : 917528-35-9	Nesfatin-1 (human) trifluoroacetate salt,CAS:917528-35-9 from ruixi.It is a synthetic peptide.It can be applied to obesitity research.	price>
R-C-3465	GLP-1-polyethylene glycol350-DSPE	Glucagon like peptide-1(GLP-1)is a kind of brain gut peptide secreted by ileal endocrine cells.It is mainly used as the target of type 2 diabetes drugs.PEG modification makes the previously insoluble peptides less soluble and highly mobile.PEG modification can reduce the filtration of drugs by kidney,reduce its pyrogen,reduce the digestion of protease, and enhance its transport capacity by protecting the body immune system.GLP-1 has two Lys located in the inactive site,which provides great flexibility for modification.	price>
R-R-5135	Naphthalene-1,4-dicarbaldehyde CAS No.:38153-01-4	Naphthalene-1,4-dicarbaldehyde/CAS No.:38153-01-4, a chemical compound, is widely used in scientific research due to its diverse applications. This versatile material finds use in organic synthesis, fluorescent labeling, and as a building block for various functional molecules. Its unique properties make it a valuable tool in numerous scientific investigations. Please inquire in advance to purchase this product.	price>
R-M-992	Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0	Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0 is a synthetic peptide.It can be used for Obesity Research.	price>
R-C-3466	Glucagon like peptide-1-PEG550-DSPE	Glucagon like peptide-1(GLP-1)is a kind of brain gut peptide secreted by ileal endocrine cells.It is mainly used as the target of type 2 diabetes drugs.PEG modification makes the previously insoluble peptides less soluble and highly mobile.PEG modification can reduce the filtration of drugs by kidney,reduce its pyrogen,reduce the digestion of protease, and enhance its transport capacity by protecting the body immune system.GLP-1 has two Lys located in the inactive site,which provides great flexibility for modification.	price>
R-R-5136	9,10-Anthracenedicarboxaldehyde CAS No.:7044-91-9	9,10-Anthracenedicarboxaldehyde/CAS No.:7044-91-9, also known as Anthracene-9,10-dicarbaldehyde, is an acene-9,10-dialdehyde and an anthracenedialdehyde . It is an aggregation-induced emission luminogens (AIEgens) and is used as a reagent in the preparation of porous imine-linked networks (PINs) . Please inquire in advance to purchase this product.	price>
R-M-993	Nesfatin-1 (30-59) (human) trifluoroacetate salt,CAS:1872441-21-8	Nesfatin-1 (30-59), YDEYLKQVIDVLETDKHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake.	price>
R-C-3467	GLP-1-PEG750-DSPE	Glucagon like peptide-1(GLP-1)is a kind of brain gut peptide secreted by ileal endocrine cells.It is mainly used as the target of type 2 diabetes drugs.PEG modification makes the previously insoluble peptides less soluble and highly mobile.PEG modification can reduce the filtration of drugs by kidney,reduce its pyrogen,reduce the digestion of protease, and enhance its transport capacity by protecting the body immune system.GLP-1 has two Lys located in the inactive site,which provides great flexibility for modification.	price>
R-R-5137	2,5-Thiophenedicarboxaldehyde CAS No.:932-95-6	2,5-Thiophenedicarboxaldehyde/CAS No.:932-95-6 is a reagent used in the synthesis of N,N-bis-(mercaptophenylimine)thiophenedicarboxaldehyde Schiff base and functions as an intermediate in many organic syntheses . It is also a natural product found in Capparis spinosa . Please inquire in advance to purchase this product.	price>
R-M-994	nesfatin-1-30-59-mouse-rat-trifluoroacetate-salt,CAS :1872441-22-9	Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment.	price>

714715716717718719 720721722723724