Home > Keywords >
| Catalog | name | Description | price |
|---|---|---|---|
| R-M1-8614 | Au/MIL-101(Cr) | The pharmaceutical molecules of 2-mercaptobenzimidazole (MBI) and 2-mercaptobenzothiazole (MBT) with so similar structures can be selectively detected by surface-enhanced Raman spectroscopy (SERS) taking advantage of the fingerprint identification on Au/MIL-101(Cr), with sensitive detection limits of 0.5 ng·mL-1 for MBI and 1 ng·mL-1 for MBT. MBI is selectively enriched by Au/MIL-101(Cr) from the mixture solution and detected by SERS below 30 ng·mL-1. MBI can also be selectively detected in the serum samples with a detection limit of 10 ng·mL-1. The thickness of the MIL-101(Cr) shell was about 120 nm, and the Au NPs (~3 nm) were dispersed on the surface and/or in the pores of MIL-101(Cr). As a kind of MOFs, MIL-101(Cr) has attracted much more attention due to its remarkable zeotype cubic structure including cell volume of ∼702,000 Å3, pore sizes of ∼29 to 34 Å, extra-large Langmuir surface area for N2 of ∼5900 m2 g −1, and its high structural and thermal stability [11,12]. Aut is ideal choices of the basal material to construct metallic nanoparticles due to their unique electronic and catalytic properties, high stability, and convenient electron-transfer ability. | price> |
| R-C-6232 | POLY(2-ETHYLHEXYL ACRYLATE) CAS:9003-77-4 | Poly(2-ethylhexyl acrylate) is a synthetic polymer that belongs to the acrylate family. It is a versatile material with diverse applications due to its unique properties.it is in the production of adhesives and sealants. | price> |
| R-M2-10249 | Acrylate-PEG-Thiol | Acrylate-PEG-Thiol/Acrylate-PEG-SH is a bifunctional polyethylene glycol derivative. Because of its bifunctional properties, this compound is widely used in the fields of biomaterial modification, drug delivery systems, hydrogel construction and surface functionalization of nanomaterials. | price> |
| R-C-7812 | PCL-PEOz-Cholesterol | Cholesterol-PEOz-PCL,PCL-PEOz-Cholesterol is a block copolymer composed of polycaprolactone (PCL),poly(2-ethyl-2-oxazoline)(PEOz),and cholesterol(Cholesterol).Due to the good biocompatibility of PCL and PEoz, and cholesterol being a natural component of cell membranes, PCL-PEOz-Cholesterol is likely to also have good biocompatibility and be suitable for the biomedical field.This product is only for scientific research and cannot be used on the human body. | price> |
| R-M1-8615 | TAT-HA2 Fusion Peptide,cas:923954-79-4 | TAT-HA2 Fusion Peptide/Trans-Activator of Transcription (TAT)-HA2 Fusion Peptide/RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG/H-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly-OH is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide induces the cellular uptake of macromolecules into endosomes via the TAT moiety and to respond to the acidifying lumen of endosomes to cause membrane leakage and release of macromolecules into cells via the HA2 moiety. | price> |
| R-C-6233 | POLY(ETHYL ACRYLATE) CAS:9003-32-1 | Poly(ethyl acrylate) is obtained by living anionic polymerization of t-butyl acrylate followed by transesterification with ethanol. | price> |
| R-M2-10250 | Acrylate-PEG-Benzaldehyde | Acrylate-PEG-Benzaldehyde is a bifunctional polyethylene glycol derivative, which is widely used in the fields of biological coupling, drug delivery systems, hydrogel construction and surface modification of nanomaterials due to its bifunctional properties. | price> |
| R-C-7813 | PCL-PEOz-Bromide | Bromide-PEOz-PCL,PCL-PEOz-Br,PCL-PEOz-Br is an amphiphilic block copolymer, and its unique advantage lies in the high activity provided by its bromine end group. Combined with the amphiphilic characteristics of PCL-PEOz, it becomes a high-performance drug delivery carrier and functional material.This product is only for scientific research and cannot be used on the human body. | price> |
| R-M1-8616 | mPEG-Phosphate, MW 5k | mPEG-Phosphate,MW5k/Diphosphate-mPEG5000/Pyrophosphate-mPEG5000/mPEG-Pyrophosphate, MW 5k/Pyrophosphate-mPEG5K/mPEG-phosphoric acid, MW 5k/Diphosphate-mPEG5000 is useful to PEGylate metal oxide particles and surfaces to form stable monolayer protection. The strong binding properties of organophosphorus to metal oxides result from the creation of a stable M-O-P structure via phosphate metal coordinative interactions. PEG Phosphate-based coupling agents form self-assembled monolayer on the surface of metal oxide nanoparticles such as iron oxide, superparamagnetic particles and upconverting and down-conversion nanoparticles to form thermodynamically stable nanoparticle dispersion. | price> |
| R-C-6234 | Poly(cyclohexyl acrylate) CAS:27458-65-7 | Poly(cyclohexyl acrylate) is a type of polymer that is formed through the polymerization of cyclohexyl acrylate monomers. This polymer can be used in various applications such as coatings, adhesives, and as a component in biomedical devices. | price> |
| R-M2-10251 | Artesunate-SS-mPEG2K | Artesunate-SS-mPEG2K/mPEG2K-SS-Artesunate/Artesunate-SS-mPEG2000 is a precursor molecule of artemether modified with polyethylene glycol (PEG), which connects the drug and carrier through a reducible disulfide bond (-SS-). It has good biocompatibility and tumor microenvironment responsiveness, and is commonly used to construct redox sensitive drug delivery systems. | price> |
| R-C-7814 | BPTU (P2Y1 Allosteric Antagonist) CAS: 870544-59-5 | BPTU (BMS-646786) is a non nucleotide P2Y1 receptor allosteric antagonist with antithrombotic activity. BPTU can block the P2Y1 receptor located at the neuromuscular junction of the gastrointestinal tract.This product is only for scientific research and cannot be used on the human body. | price> |
| R-M1-8617 | 3-Azido-D-alanine HCl,cas1379690-01-3 | 3-Azido-D-alanine HCl/3-Azido-D-alanine hydrochloride/CAS1379690-01-3 is an aliphatic functionalized amino acid with side chain lengths of up to four carbons.In the area of peptide synthesis as a powerful tool in the development of new therapeutics and biochemistry research. Such modified amino acids can easily undergo click reaction. | price> |
| R-C-6235 | POLY(TERT-BUTYL ACRYLATE) CAS:25232-27-3 | Poly(tert-butyl acrylate) is a type of polymer that is formed through the polymerization of tert-butyl acrylate monomers.This polymer can be used in various applications such as coatings, adhesives, and elastomers. It has properties such as being flexible,weather-resistant, and having good adhesion to various substrates. | price> |
| R-M2-10252 | CY3-Artesunate | Cy3-Artesunate/Cyanine3-Artesunate is a fluorescent labeled prodrug that covalently links the red fluorescent dye Cy3 to the molecule of Artesunate. It combines drug activity and optical tracking ability, and is widely used in anti-tumor mechanism research and targeted delivery system development. | price> |
| R-C-7815 | MRS2500 tetraammonium (P2Y1 receptor antagonist) CAS:630103-23-0 96% | MRS 2500 quaternary ammonium salt is a potent selective antagonist of platelet P2Y1 receptor (Ki=0.78nM).Inhibition of adp induced human platelet aggregation with an IC50 value of 0.95 nM. Upregulation of ntpase e1 is inhibited by ATP γ S. Prevent the formation of blood clots in the body.This product is only for scientific research and cannot be used on the human body. | price> |
| R-M1-8618 | DOTA-PEG4-DBCO | DOTA-PEG(4)-DBCO/DOTA-PEG4-dibenzocyclooctyne/DOTA-PEG4-DBCO(dibenzocyclooctyne)/DBCO-PEG4-DOTA is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs. | price> |
| R-C-6236 | POLY(N-BUTYL ACRYLATE) CAS:9003-49-0 | Poly(n-butyl acrylate) is a polymer that is formed through the polymerization of n-butyl acrylate monomers. It is a versatile polymer commonly used in the production of adhesives, coatings, sealants, and elastomers. Poly(n-butyl acrylate) exhibits properties such as flexibility, good adhesion, and weather resistance, making it suitable for various applications. | price> |
| R-M2-10253 | CY5-Artesunate | Cy5-Artesunate/Cyanine5-Artesunate is a multifunctional probe molecule formed by covalently coupling Artesunate with near-infrared fluorescent dye Cy5, which combines drug activity and optical visualization ability. It is widely used in anti-tumor, anti malaria mechanism research, and real-time tracking of drug delivery systems. | price> |
| R-C-7816 | DSPE-TK-PEG-SS31-FITC | DSPE-TK-PEG2K-SS31-FITC,1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-thioketal(TK)-polyethylene glycol-SS-31(H-D-ARG-DMT-LYS-PHE-NH2)-Fluorescein,DSPE-TK-PEG-SS31-FITC is a multifunctional composite molecule that integrates lipid anchoring,ROS response,mitochondrial targeting, and fluorescence imaging.It has important application value in the construction of nano delivery systems,subcellular localization research,and development of stimulus responsive materials.It is a typical intelligent multi module fluorescent functional material.This product is only for scientific research and cannot be used on the human body. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


