Home > Keywords >
| Catalog | name | Description | price |
|---|---|---|---|
| R-M2-10086 | ZIF-8 modified with N3,300-500nm | ZIF-8 modified with N3,300-500nm/N3 modified ZIF-8 can be used for drug delivery,biosensing, immunotherapy, photocatalysis,CO2 conversion, gas/liquid separation, SERS detection.It can also be used for antibacterial materials. Notes: Dispersion method of solid dry powder: Take an appropriate amount of solid dry powder as needed, add pure water until the freeze-dried powder is completely dissolved, and use water bath ultrasound for 5-30 seconds to promote the dispersion of nanomaterials. If the dispersion is not complete, the water bath ultrasound time can be extended to 2 minutes. If physiological saline or buffer solution is needed for dispersion, please add an equal volume of 2 x physiological saline or buffer solution to make the final concentration of physiological saline or buffer solution 1 x normal concentration. | price> |
| R-M1-8452 | Methyltetrazine-DBCO | Methyltetrazine-DBCO compound is particularly useful in bioconjugation, labeling, and imaging applications. It enables the selective and bioorthogonal labeling of biomolecules or surfaces, allowing for the visualization and tracking of specific targets or structures. This compound is often used in combination with other imaging agents or labels to facilitate the detection and study of biological processes in cells or living organisms. | price> |
| R-C-6070 | MOPC (17:0/18:1 PC) | 1-Margaroyl-2-oleoyl-sn-glycero-3-phosphocholine (MOPC,17:0/18:1 PC) is phosphocholine with heptadecanoyl and oleoyl acyl groups.Phosphatidylcholine(PC)is generally the most abundant lipid in animal cell membranes providing structural framework.PC is more common in the outer leaflet where it functions as part of the permeability barrier. | price> |
| R-M2-10087 | N3 modified MIL-101,300-500nm | N3 modified MIL-101,300-500nm/Azide modified MIL-101/MIL-101 modified with azide is a chemically modified metal organic framework (MOF) material. Application: Gas adsorption and separation: By utilizing its high specific surface area and porous structure, gas molecules can be adsorbed and separated. Catalysis: As a catalyst or catalyst carrier, it participates in various chemical reactions. Biomedical: has potential applications in drug delivery, bioimaging, and biosensing. Environmental remediation: used to remove pollutants from water or harmful gases from the air. Notes: Dispersion method of solid dry powder: Take an appropriate amount of solid dry powder as needed, add pure water until the freeze-dried powder is completely dissolved, and use water bath ultrasound for 5-30 seconds to promote the dispersion of nanomaterials. If the dispersion is not complete, the water bath ultrasound time can be extended to 2 minutes. If physiological saline or buffer solution is needed for dispersion, please add an equal volume of 2 x physiological saline or buffer solution to make the final concentration of physiological saline or buffer solution 1 x normal concentration. | price> |
| R-M1-8453 | Methyltetrazine-PEG12-DBCO | By combining the methyltetrazine group, PEG12 linker, and DBCO group, the methyltetrazine-PEG12-DBCO compound can have potential applications in various fields. The compound click chemistry reactivity allows for efficient and selective conjugation with other molecules or surfaces that contain complementary dienophile or diene groups. The PEG linker enhances solubility and biocompatibility, and the overall structure enables the incorporation of functionalities or modifications for specific applications, such as targeted drug delivery, bioimaging, or surface modification. | price> |
| R-C-6071 | ms-PtdIns(4,5)P2 diC16 CAS:888472-72-8 | ms-PtdIns(4,5)P2 diC16,also known as phosphatidylinositol 4,5-bisphosphate diC16,is a lipid molecule involved in cell signaling pathways.It belongs to the phosphoinositide family and is a key regulator of various cellular processes,including cell proliferation,cytoskeletal organization,membrane trafficking,and signal transduction. | price> |
| R-M2-10088 | Carbon nanotubes modified with azide | Carbon nanotubes modified with azide can enhance the mechanical properties (such as impact strength) of matrices such as resins and polyurethanes. Nitrogen doped carbon nanotubes (similar technology) can enhance electrocatalytic activity and capacitance performance. Notes: Dispersion method of solid dry powder: Take an appropriate amount of solid dry powder as needed, add pure water until the freeze-dried powder is completely dissolved, and use water bath ultrasound for 5-30 seconds to promote the dispersion of nanomaterials. If the dispersion is not complete, the water bath ultrasound time can be extended to 2 minutes. If physiological saline or buffer solution is needed for dispersion, please add an equal volume of 2 x physiological saline or buffer solution to make the final concentration of physiological saline or buffer solution 1 x normal concentration. | price> |
| R-M1-8454 | Cy5 Methyltetrazine | Cy5 Methyltetrazine refers to a specific chemical compound that consists of a fluorescent dye called Cy5 conjugated to a methyltetrazine moiety. By combining the fluorescent properties of Cy5 and the reactivity of methyltetrazine, Cy5 Methyltetrazine can be employed in various biological and chemical applications. It is often used for site-specific labeling of biomolecules, such as proteins or nucleic acids, to visualize their localization or interactions. The NIR emission of Cy5 is particularly advantageous in imaging applications, as it allows for deep tissue imaging with minimal background fluorescence. | price> |
| R-C-6072 | ms-PtdIns(4,5)P2 diC8 CAS:888472-73-9 | Ms-PtdIns(4,5)P2 diC8 is a water-soluble,synthetic PI(4,5)P2 analog in which the phosphodiester bond has been rendered metabolically stable via the α-fluorophosphonate. | price> |
| R-M2-10089 | Ferrocene-DBCO | Ferrocene-DBCO has copper free click chemistry activity, electrochemical and biocompatibility.It is suitable for biomolecule labeling, drug delivery system construction, and biomaterial functionalization. | price> |
| R-M1-8455 | NH2-PEG-TCO | NH2-PEG-TCO,Amine-polyethylene glycol-Transcyclooctene is a versatile compound that can be used in bioconjugation, drug delivery, surface modification, and other chemical and biological applications. Its specific properties and potential applications may depend on the intended purpose and the specific chemical and biological environment in which it is used. Different variations or modifications of the compound may exist to tailor its reactivity, solubility, or targeting capabilities for specific applications. | price> |
| R-C-6073 | N-Linoleoyl-DPPE cas:2148334-94-3 | 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-linoleoyl(N-linoleoyl-DPPE)is a specific non-endocannabinoid type of N-acylphosphatidylethanolamine (NAPE).NAPEs are the substrates of a specific phospholiase D(NAPE-PLD)which produces aqueous-soluble bioactive fatty acid amides or N-acylethanolamines. | price> |
| R-M2-10090 | Intermediate FAPI-46 | Intermediate FAPI-46 customized product, from ruixibio/kamulinbio.FAPI-46 is a quinoline based fibroblast activation protein (FAP) targeted radiotracer primarily used for tumor imaging of various cancers. Its characteristics include higher tumor uptake rate and prolonged tumor accumulation time. | price> |
| R-M1-8456 | TCO-PEG-MAL | TCO-PEG-MAL,Transcyclooctene-polyethylene glycol-Maleimide from ruixibio.The TCO group in TCO-PEG-MAL is a dienophile that can undergo a rapid and selective reaction with certain diene groups, such as tetrazine or trans-cyclooctene groups. This reaction is commonly used in bioorthogonal chemistry for the specific and efficient conjugation of molecules.By combining the TCO group, PEG linker, and MAL group, TCO-PEG-MAL can be utilized in various chemical and biological applications. It can be used for the conjugation of TCO-PEG-MAL with diene-containing molecules or surfaces using the Diels-Alder or other bioorthogonal click reactions. The presence of the maleimide group also allows for the specific and selective modification of proteins or peptides containing cysteine residues. | price> |
| R-C-6074 | N-Oleoyl-DPPE CAS:113701-57-8 | 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-oleoyl(N-oleoyl-DPPE)is a type of N-acylphosphatidylethanolamine(NAPE)and an important intermediate in the endocannabinoid biosynthesis pathway.Fatty acid amides are synthesized by a specific phospholiase D(NAPE-PLD)and metabolized by fatty acid amide hydrolases(FAAH)and N-Acylethanolamine acid amidase (NAAA). | price> |
| R-M2-10091 | Ferrocene-Azide | Ferrocene Azide is an organic metal compound that combines ferrocene and azide groups The ferrocene moiety provides stable electron transfer ability, and the azide group can efficiently couple biomolecules or nanomaterials through click chemistry (such as reacting with alkynyl groups). Functional application: Electrochemical labeling: used for labeling antibodies, nucleic acids, etc., achieving high-sensitivity detection through the redox signal of ferrocene. Drug delivery: As a responsive carrier, it triggers drug release in the tumor microenvironment. Biosensors: Modify electrodes to detect small molecules such as H2O2 and lactic acid. Synthesis and stability: Solid phase peptide synthesis or click chemical connection is required, and it should be dried and stored in the dark to maintain activity. | price> |
| R-MC-001 | C18-PEG2k-NOTA | By combining the C18 alkyl group, PEG2k linker, and NOTA chelating agent, C18-PEG2k-NOTA can have potential applications in various fields, such as the development of targeted drug delivery systems, imaging agents, or radiopharmaceuticals. The compounds amphiphilic nature, hydrophobicity, and metal chelation properties make it a versatile candidate for designing functional materials in drug discovery, medical diagnostics, or molecular imaging. | price> |
| R-C-6075 | N-palmitoyl-DPPE (NAPE 16:0) CAS:57984-41-5 | 1,2-Dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-palmitoyl(N-palmitoyl-DPPE)is a type of N-acylphosphatidylethanolamine(NAPE)which as a group includes substrates in the endocannabinoid biosynthesis pathway. | price> |
| R-M2-10092 | CYTIWMPENPRPGTPCDIFTNSRGKRASNG-peg-DMG | The core sequence of CYTIWMPENPRPGTPCDIFTNSRGKRASNG peg DMG is derived from the rabies virus glycoprotein (RVG29) and has the ability to penetrate the blood-brain barrier (BBB). PEGylation can enhance its water solubility and stability, while DMG modification may be used to improve drug delivery properties or bind to specific targets. This peptide is mainly used for targeted therapy of brain diseases, such as drug delivery for neurodegenerative diseases or brain tumors. | price> |
| R-M1-8458 | Bromide-PEG3-biotin | Bromide-Polyethylene glycol--biotin,Bromide-PEG-biotin from ruixi.Biotin can bind to avidin and streptavidin with high specificity and affinity.Bromide-PEG-biotin is a linear heterobifunctional PEG reagent with a Bromide a succinimidyl biotinl ester group. It is a useful crosslinking reagent with a PEG spacer. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


