Home > Keywords > 
Catalog name Description price
R-M1-8611 CY5@LNP-RGD(100nm) CY5@Lipid Nanoparticles-RGD(100nm)/CY5@LNP-RGD(100nm)/CY5@RGD-Modified Lipid Nanoparticles(100nm)/Cyanine5@RGD-Modified Lipid Nanoparticles containing a novel pH-sensitive and biodegradable lipid Nanoparticles. It can be used for targeted drug delivery and cancer research. price>
R-C-6229 POLY(2-ACRYLAMIDO-2-METHYLPROPANESULFONIC ACID SODIUM SALT) Synonym: Poly(sodium 2-acrylamido-2-methyl-propanesulfonate).Poly(2-acrylamido-2-methylpropanesulfonic acid sodium salt) or Poly(AMPS)is a synthetic polymer that contains sulfonic acid groups.Due to the presence of sulfonic acid groups,Poly(AMPS)is also utilized as an ion-exchange resin to remove heavy metal ions and other impurities from water.Moreover, its high thermal stability makes it suitable for use in high-temperature applications. price>
R-M1-8612 CY5@LNP(100nm) Cyanine5@LNP(100nm)/CY5@LNP(100nm) /CY5@liposome nanoparticles(100nm) /Cyanine5@liposome nanoparticles(100nm) containing a novel pH-sensitive and biodegradable lipid Nanoparticles. It can be used for targeted drug delivery and cancer research. price>
R-C-6230 POLY(ACRYLAMIDE) CAS:9003-05-8 Poly(acrylamide) is a synthetic polymer that is widely used in various industrial and scientific applications.One of the main applications of poly(acrylamide)is as a flocculant in water treatment processes. It is used to remove solids and impurities from water by causing particles to clump together and settle out, making it easier to separate them from the water. price>
R-M1-8613 D-α-tocopheryl polyethylene glycol succinate-NHS D-α-tocopheryl polyethylene glycol succinate-NHS/TPGS-NHS/d-α-tocopheryl polyethylene glycol succinate (TPGS)-NHS/d-α-tocopheryl polyethylene glycol succinate N-hydroxylsuccinimide/TPGS-N-hydroxylsuccinimide can as a potential carrier for controlled delivery of the drug.TPGS can target the mitochondria of cancer cells and leads to their destruction by activating mitochondrial apoptosis mediators This anticancer activity has been shown against cancer cells only and does not affect healthy cells TPGS has been explored in combination therapy with many anticancer drugs, including DOX-loaded nanocarriers. price>
R-C-6231 POLY(ISOPROPYL ACRYLATE) CAS:26124-32-3 Poly(isopropyl acrylate)is a synthetic polymer that belongs to the class of polyacrylates.It is used in adhesives, coatings,and also as a material for controlled drug delivery systems thanks to its responsiveness to temperature and solvent changes. price>
R-M1-8614 Au/MIL-101(Cr) The pharmaceutical molecules of 2-mercaptobenzimidazole (MBI) and 2-mercaptobenzothiazole (MBT) with so similar structures can be selectively detected by surface-enhanced Raman spectroscopy (SERS) taking advantage of the fingerprint identification on Au/MIL-101(Cr), with sensitive detection limits of 0.5 ng·mL-1 for MBI and 1 ng·mL-1 for MBT. MBI is selectively enriched by Au/MIL-101(Cr) from the mixture solution and detected by SERS below 30 ng·mL-1. MBI can also be selectively detected in the serum samples with a detection limit of 10 ng·mL-1. The thickness of the MIL-101(Cr) shell was about 120 nm, and the Au NPs (~3 nm) were dispersed on the surface and/or in the pores of MIL-101(Cr). As a kind of MOFs, MIL-101(Cr) has attracted much more attention due to its remarkable zeotype cubic structure including cell volume of ∼702,000 Å3, pore sizes of ∼29 to 34 Å, extra-large Langmuir surface area for N2 of ∼5900 m2 g −1, and its high structural and thermal stability [11,12]. Aut is ideal choices of the basal material to construct metallic nanoparticles due to their unique electronic and catalytic properties, high stability, and convenient electron-transfer ability. price>
R-C-6232 POLY(2-ETHYLHEXYL ACRYLATE) CAS:9003-77-4 Poly(2-ethylhexyl acrylate) is a synthetic polymer that belongs to the acrylate family. It is a versatile material with diverse applications due to its unique properties.it is in the production of adhesives and sealants. price>
R-M1-8615 TAT-HA2 Fusion Peptide,cas:923954-79-4  TAT-HA2 Fusion Peptide/Trans-Activator of Transcription (TAT)-HA2 Fusion Peptide/RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG/H-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly-OH is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide induces the cellular uptake of macromolecules into endosomes via the TAT moiety and to respond to the acidifying lumen of endosomes to cause membrane leakage and release of macromolecules into cells via the HA2 moiety. price>
R-C-6233 POLY(ETHYL ACRYLATE) CAS:9003-32-1 Poly(ethyl acrylate) is obtained by living anionic polymerization of t-butyl acrylate followed by transesterification with ethanol. price>
R-M1-8616 mPEG-Phosphate, MW 5k mPEG-Phosphate,MW5k/Diphosphate-mPEG5000/Pyrophosphate-mPEG5000/mPEG-Pyrophosphate, MW 5k/Pyrophosphate-mPEG5K/mPEG-phosphoric acid, MW 5k/Diphosphate-mPEG5000 is useful to PEGylate metal oxide particles and surfaces to form stable monolayer protection. The strong binding properties of organophosphorus to metal oxides result from the creation of a stable M-O-P structure via phosphate metal coordinative interactions. PEG Phosphate-based coupling agents form self-assembled monolayer on the surface of metal oxide nanoparticles such as iron oxide, superparamagnetic particles and upconverting and down-conversion nanoparticles to form thermodynamically stable nanoparticle dispersion. price>
R-C-6234 Poly(cyclohexyl acrylate) CAS:27458-65-7 Poly(cyclohexyl acrylate) is a type of polymer that is formed through the polymerization of cyclohexyl acrylate monomers. This polymer can be used in various applications such as coatings, adhesives, and as a component in biomedical devices. price>
R-M1-8617 3-Azido-D-alanine HCl,cas1379690-01-3 3-Azido-D-alanine HCl/3-Azido-D-alanine hydrochloride/CAS1379690-01-3 is an aliphatic functionalized amino acid with side chain lengths of up to four carbons.In the area of peptide synthesis as a powerful tool in the development of new therapeutics and biochemistry research. Such modified amino acids can easily undergo click reaction. price>
R-C-6235 POLY(TERT-BUTYL ACRYLATE) CAS:25232-27-3 Poly(tert-butyl acrylate) is a type of polymer that is formed through the polymerization of tert-butyl acrylate monomers.This polymer can be used in various applications such as coatings, adhesives, and elastomers. It has properties such as being flexible,weather-resistant, and having good adhesion to various substrates. price>
R-M1-8618 DOTA-PEG4-DBCO DOTA-PEG(4)-DBCO/DOTA-PEG4-dibenzocyclooctyne/DOTA-PEG4-DBCO(dibenzocyclooctyne)/DBCO-PEG4-DOTA is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs. price>
R-C-6236 POLY(N-BUTYL ACRYLATE) CAS:9003-49-0 Poly(n-butyl acrylate) is a polymer that is formed through the polymerization of n-butyl acrylate monomers. It is a versatile polymer commonly used in the production of adhesives, coatings, sealants, and elastomers. Poly(n-butyl acrylate) exhibits properties such as flexibility, good adhesion, and weather resistance, making it suitable for various applications. price>
R-M1-8619 Cy3-Dapagliflozin Cyanine3 Dapagliflozin /Dapagliflozin Cyanine3/Cyanine3-Dapagliflozin/Dapagliflozin-Cyanine3/Dapagliflozin-Cy3/Cy3 Dapagliflozin is a fluorescent pathway labeled molecule.It can be used to study the field of type 2 diabetes (T2D). price>
R-C-6237 POLY(N-OCTYL ACRYLATE) cas:25266-13-1 PnOctA,Poly(n-octyl acrylate) is a polymer that is formed through the polymerization of n-octyl acrylate monomers.poly(n-octyl acrylate) possesses good weather resistance, which makes it suitable for outdoor applications. price>
R-M1-8620 UiO-66(Ce)-CH3 A series of functionalized metal–organic frameworks (MOFs):UiO-66(Ce)-CH3/Universitetet i Oslo-66(cerium)-CH3 for the photocatalytic oxidation of benzylamine under visible light. And it has a high conversion rate. The quantity and the acid strength of coordinatively unsaturated Ce sites as Lewis acid sites are modulated by ligand functionalization, both following the order of UiO-66(Ce)-CH3 > UiO-66(Ce)-H > UiO-66(Ce)-Br > UiO-66(Ce)-NO2, which is closely related to photocatalytic performance. price>
R-C-6238 POLY(N-NONYL ACRYLATE) Poly(n-nonyl acrylate)is a polymer that is formed through the polymerization of n-nonyl acrylate monomers.It is utilized in a range of applications,including coatings,adhesives,and sealants.The polymer possesses properties such as flexibility and adhesion,making it suitable for various industrial uses.Poly(n-nonyl acrylate)is also employed in the production of paints,inks,and pressure-sensitive adhesives due to its capacity to adhere to a variety of surfaces.For further information on its characteristics,potential uses,or safety considerations,consulting specific chemical databases or regulatory sources may be beneficial. price>