Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-M1-8000	DMG-peg(mw600)-sialic acid	Sialic acid widely exists in animal tissues and is also distributed in a small amount in other organisms. It is mainly used as a component of glycoproteins and gangliosides.	price>
R-C-5617	Fe3O4 nanorods length:100~300nm,diameter:50nm	Fe3O4 nanorods have many important applications. Due to their magnetic and shape controllability, they can be used in fields such as magnetic separation, drug delivery, and magnetic resonance imaging. In addition, Fe3O4 nanorods can also be used to prepare new materials such as batteries, catalysts, sensors, etc.	price>
R-M2-9635	Simvastatin-TK-Heparin	The combination of Simvastatin, TK (if referring to thrombosis treatment), and Heparin could play a role in comprehensive care for patients at high risk for thrombotic events, particularly in acute scenarios. This would typically occur under close clinical supervision due to the complexities involved with anticoagulation and statin therapy. All products we provide are for scientific research purposes only and cannot be used for the human body.	price>
R-C-7197	DSPE-TK-PEG-M2pep	DSPE-TK-PEG-M2pep,DSPE provides the basis for liposome membrane structure,with ketothiol bonds that break in a reducing environment(such as high ROS in tumors), releasing PEG chains.PEG(polyethylene glycol) enhances water solubility,cycling stability, and targeting.M2pep(M2 macrophage-targeting peptide)is a linear peptide screened on M2 macrophages using phage display technology,with the sequence YEQDPWGVKWHY.	price>
R-M1-8001	DBCO-PEG350-FA	Applicated in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. DBCO-PEG-FA can go Click Chemistry reaction without a needof any catalysts.	price>
R-C-5618	PVIMDZQ-Osmium	PVIMDZQ-Osmium is characterized by the presence of imidazole and bipyridine ligands coordinated to the osmium(II) center.The quaternization of the N-vinyl imidazole groups enhances the water solubility and stability of the polymer complex.POLY(N-VINYL IMIDAZOLE, QUATERNIZED WITH BIS[2,2-BIPYRIDINE-N,N]-OSMIUM(II) COMPLEX) is a unique polymer complex with redox activity and light absorption properties. Its quaternization and coordination chemistry make it useful for diverse applications in areas like electrochemistry, catalysis, materials science, and bio-related research.	price>
R-M2-9636	NH2-TK-COOH	NH2-TK-COOH,NH2-Thioketal-COOH can serve as intermediates in various organic synthesis routes, particularly in the preparation of sulfur-containing compounds. Investigating thioketals for activity against specific biological targets, especially if they can be used to modify pharmacological agents. Thioketals might be used in the design of materials with specific electrical or optical properties or in polymer chemistry.	price>
R-C-7198	DSPE-PEG-CPLGLAGSRDIYSTDYYR(PEG-NH2)	DSPE-PEG-CPLGLAGSRDITDYYR is a class of functionalized molecules constructed by chemical coupling of distearoyl phosphatidylethanolamine(DSPE),polyethylene glycol (PEG),and CPLGLAGSRDITDYYR.Its core structure integrates the hydrophobic properties of DSPE,the hydrophilic stability of PEG,and the interface recognition or targeting ability of peptides through covalent bonds,forming a structurally clear and functionally adjustable self-assembly system.	price>
R-M1-8002	DBCO-PEG550-Folic Acid	DBCO-PEG-FA can go Click Chemistry reaction without a needof any catalysts.Applicated in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.	price>
R-C-5619	POLY(N-VINYL IMIDAZOLE,QUATERNIZED WITH METHYL IODIDE)	POLY(N-VINYL IMIDAZOLE,QUATERNIZED WITH METHYL IODIDE)exhibits pH-responsive behavior, swelling and contracting in response to changes in pH.This property can be exploited in drug delivery systems to release encapsulated drugs or other molecular cargo on demand.PVMIm can also interact with biological molecules,such as DNA and proteins,due to its quaternary ammonium groups.This enables its use in applications like gene delivery, where the positively charged polymer can form complexes with negatively charged DNA,facilitating their cellular uptake.	price>
R-M2-9637	HS-PEG1000-TK-PEG1000-SH	HS-PEG1000-TK-PEG1000-SH is a versatile compound likely designed for applications in drug delivery and bioconjugation. This molecule can be utilized to stabilize nanoparticles in a biological environment, providing a protective coating that enhances biocompatibility.The thiol groups may be used in various chemical reactions, including crosslinking applications, to form hydrogels or other materials.The reactive thiol groups can be employed in the development of sensors, allowing for the detection of specific biomolecules through molecular interactions.	price>
R-C-7199	DSPE-PEG-CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH)	DSPE-PEG-CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) is a class of functionalized molecules constructed by chemical coupling of distearoyl phosphatidylethanolamine(DSPE),polyethylene glycol (PEG),and CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) . Its core structure integrates the hydrophobic properties of DSPE,the hydrophilic stability of PEG,and the interface recognition or targeting ability of peptides through covalent bonds,Used to achieve targeted delivery or other functions.	price>
R-M1-8003	Dibenzocycolctyne-PEG750-Folic Acid	DBCO-PEG-FA can go Click Chemistry reaction without a needof any catalysts.Applicated in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.	price>
R-C-5620	DSPE-PCB	DSPE-PCB20 had the same ability to enhance the serum stability of lipoplexes. However, quite different from the PEGylation, zwitterionic DSPE-PCB20 could offer stability without interfering with the siRNA encapsulation efficiency and endosomal/lysosomal escape ability of lipoplexes, which was favorable for the systemic delivery of siRNA.	price>
R-M2-9638	Adamantane-PAA modified core-shell upconversion nanoparticles NaYF4:Yb,Er@NaYF4:Nd,Yb@NaYF4	ADA-PAA modified core-shell upconversion nanoparticles NaYF4:Yb,Er@NaYF4:Nd,Yb@NaYF4 (808 excitation, green light) describes a sophisticated nanostructure designed for enhanced luminescent properties, for advanced imaging, phototherapy, or sensing applications. The unique properties of the adamantane and PAA modifications, along with the core-shell architecture, play pivotal roles in improving the stability and functionality of these nanomaterials.	price>
R-C-7200	DMPE-PEG-KYIKFKHDYNILEFNDGTFE-K-FI	DMPE is a phospholipid molecule containing myristoyl and phosphatidylcholine.The hydrophobic chain of DMPE facilitates its embedding in biological membranes or liposomes,enhancing the binding between molecules and membranes.PEG is a hydrophilic polymer used to increase the water solubility and biocompatibility of molecules.PEG has good flexibility,which can improve the solubility and stability of molecules,and reduce non-specific binding.It can couple various peptides(KYIKFKHDYNILEFNDGTFE-K-FI) and small molecule groups.	price>
R-M1-8004	Methyltetrazine-NHS Ester,Cas:1644644-96-1	Methyltetrazine-NHS ester is a linker for bio-conjugation that contains a methyltetrazine group and a terminal NHS ester group.	price>
R-C-5621	DSPE-PEG2000-TFFYGGSRGKRNNFKTEEY	The peptide sequence Angiopep-2 (TFFYGGSRGKRNNFKTEEYC) is a specific targeting peptide derived from the protein fibronectin. This peptide is known to have affinity for certain receptors or molecules present on the surface of specific cell types. By conjugating this peptide to DSPE-PEG2000, the liposomes or nanoparticles can potentially target and bind to the corresponding receptors on specific cells.	price>
R-M2-9639	Adamantane-BSA	Adamantane-BSA,Adamantane-bovine serum albumin represents a versatile conjugate with significant implications in drug delivery, targeting, imaging, and other therapeutic applications. Adamantane can be used for bioconjugation with targeting ligands (e.g., antibodies or peptides) to direct BSA to specific tissues or cells, enhancing drug delivery mechanisms. The Adamantane-BSA conjugate can serve as a stabilizing agent or template for the synthesis of nanoparticles or other nano-carriers, improving the stability and functionality of drug delivery systems.	price>
R-C-7201	DSPE-TK-PEG-CSTSMLKAC	DSPE-TK-PEG-CTSSMLKAC is a ROS responsive nanomaterial that combines phospholipids,polyethylene glycol(PEG),and cardiac targeting peptides(CSTSMLKAC).It has targeted delivery and controlled release functions and is mainly used in the treatment of myocardial diseases or drug delivery systems Thioketal is a ROS responsive linker that can be cleaved in high reactive oxygen species(ROS)environments,enabling controlled drug release.	price>

105010511052105310541055 10561057105810591060