Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-M2-9541	DBCO-HSA	By attaching therapeutic agents to HSA via DBCO(DBCO-HSA/DBCO-human serum albumin/DBCO-Albumin from human serum/Human serum albumin-DBCO),the pharmacokinetics of the drug can be modified, leading to prolonged circulation times and targeted delivery to tissues expressing particular receptors or characteristics. DBCO is often used in bioconjugation strategies to covalently link proteins, peptides, or other biomolecules to HSA. This is particularly useful in developing targeted therapeutics or diagnostic agents. Conjugation of imaging agents (e.g., fluorescent markers, radioactive isotopes) to HSA through DBCO facilitates the tracking and visualization of biological processes in medical imaging techniques. HSA is sometimes used as a carrier for vaccine antigens. By conjugating antigens to HSA, the immune response can be improved due to the stable and biocompatible nature of the protein. HSA conjugates can also be used to deliver biologically active compounds, enzymes, or hormones effectively, targeting specific tissues or cells based on the characteristics of HSA and the associated payload.	price>
R-C-7103	ALC-0159-Mal	ALC-0159-mal is a core stabilizing component used in lipid nanoparticle(LNP)technology for mRNA vaccines and nucleic acid drug delivery.It forms a spatially blocking protective layer through hydrophilic PEG chains to prevent particle aggregation or fusion and maintain particle size uniformity.	price>
R-M-7011	IRDye® 680RD COOH	IRDye® 680RD Carboxylate can assays that use IRDye 680RD conjugates,such as small animal imaging and cell binding assays.Carboxylate (non-reactive) form of IRDye 680RD is an ideal control.	price>
R-C-5524	DSG-PEG cas:308805-39-2	Phospholipids refer to lipids containing phosphoric acid and belong to the category of complex lipids. Phospholipids are the main component of biofilms, consisting of amphiphilic molecules with a hydrophilic nitrogen or phosphorus containing head at one end and a hydrophobic (lipophilic) long hydrocarbon chain at the other end. For this reason, the hydrophilic ends of phospholipid molecules are close to each other and the hydrophobic ends are close to each other, often forming a Lipid bilayer together with other molecules such as protein, glycolipids, cholesterol, etc.	price>
R-M2-9542	Mal-PEG4-trimethylammonium chloride	Mal-PEG4-trimethylammonium chloride is a versatile reagent that combines the benefits of maleimide-mediated bioconjugation with the properties of polyethylene glycol (PEG) and cationic trimethylammonium groups. The maleimide functionality allows for selective conjugation of fluorescent dyes, drugs, or other molecules to proteins, enabling their use in imaging, tracking, or therapeutic applications.The positively charged trimethylammonium can facilitate the formation of nanoparticles or complexes that enhance the delivery of nucleic acids (like DNA or RNA) or other therapeutics into cells. The compound can be used to create ADCs by linking a cytotoxic drug to an antibody via the maleimide group, allowing targeted delivery of the drug to cancer cells.It can be used to modify surfaces of medical devices or scaffolds to improve biocompatibility or enable further functionalization.	price>
R-C-7104	DSPE-PEG-Ser-Phe-His-Gln-Phe-Ala-Arg-Ala-Thr-Leu-Ala-Ser	DSPE-PEG-Ser-Phe-His-Gln-Phe-Ala-Arg-Ala-Thr-Leu-Ala-Ser is a targeted delivery system composed of phospholipids,polyethylene glycol(PEG),and specific amino acid sequences,commonly used in drug delivery,gene therapy,and other fields. In the construction of liposome nanoparticles,DSPE-PEG regulates surface properties, enhances drug stability and targeting.	price>
R-M-7012	IRDye® 800RS NHS Ester	IRDye 800RS NHS ester is an excellent choice for nucleic acid applications. This near-infrared fluorescence dye has good water solubility, but low salt tolerance. It is more hydrophobic than IRDye 800CW.IRDye 800RS NHS ester can be used to label the primary and secondary amino groups of DNA and RNA. Nucleic acids that have been labeled with IRDye 800RS can be easily purified by reverse-phase chromatography.	price>
R-C-5525	DSPE-PEG2000-SS-RGD	DSPE stands for 1,2-distearoyl-sn-glycero-3-phosphoethanolamine,which is a phospholipid derivative commonly used in drug delivery systems.PEG2000 refers to polyethylene glycol 2000,a polymer that provides stability and solubility to the compound. SS can be cleaved in response to specific stimuli such as the presence of reducing agents. RGD is the abbreviation for the amino acid sequence Arg-Gly-Asp,which is a recognition motif for integrin receptors commonly found on cells.	price>
R-M2-9543	Cholesterol-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG	Cholesterol-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG/YGMSPRNRTGSNKPNCIRAIWPTFTEPDG-PEG1000-Cholesterol is a sophisticated biomolecule consisting of cholesterol for membrane engagement, PEG for solubility and circulation enhancement, and a specific peptide for targeted delivery or bioactivity. Such conjugates are increasingly utilized in research and clinical applications, especially for drug delivery systems and targeted therapies, due to their inherent advantages in enhancing stability, providing targeting capabilities, and reducing side effects.	price>
R-C-7105	DSPE-PEG-GPC3(DHLASLWWGTEL)	GPC3(DHLASLWWGTEL)-PEG-DSPE,DSPE-PEG-GPC3(DHLASLWWGTEL)is a targeted functionalized lipid polyethylene glycol peptide complex designed specifically for targeted delivery systems.Its core function is to achieve precise targeting of GPC3 overexpressing tumors such as liver cancer by specifically binding to the Glypican-3 (GPC3)receptor through the peptide sequence(DHLASLWWGTEL).	price>
R-M-7013	IRDye® QC-1 NHS Ester	IRDye QC-1 is the first non-fluorescent (dark) quencher compatible with a wide range of visible and near-infrared fluorophores (500-800 nm). It has the widest available quenching range, so you do not need to carefully match the donors fluorescence spectrum with the acceptors absorbance. IRDye QC-1 quenches common fluorophores with more than 97% efficiency1.	price>
R-C-5526	PLGA-TK-PEG-Biotin	PLGA refers to poly(lactic-co-glycolic acid), which is a biodegradable and biocompatible polymer commonly used in drug delivery systems. TK represents thymidine kinase, an enzyme involved in the metabolism of nucleosides. PEG stands for polyethylene glycol, a hydrophilic polymer that enhances the solubility and stability of the compound. Biotin is a vitamin that serves as a recognition moiety for binding to avidin or streptavidin, allowing for targeted delivery to cells expressing the avidin or streptavidin receptor.	price>
R-M2-9544	DMG-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG	DMG-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG is a versatile molecule potentially applicable in various scientific and medical fields.It could be utilized for effective drug delivery, targeted therapy, or research into cell biology and interactions.	price>
R-C-7106	DSPE-PEG-iRGD-FITC	DSPE(1,2-distearoyl-sn-glycerin-3-phosphoethanolamine) As a hydrophobic fatty acid tail, it can be stably embedded in the hydrophobic layer of liposomes or nanocarriers, providing structural stability.PEG-iRGD-FITC is a hydrophilic head that is amphiphilic as a whole, making it easy to insert into the surface of liposomes or other nanocarriers and achieve stable membrane anchoring.	price>
R-M-7014	IRDye® 700 Phosphoramidite,cas:648882-22-8	IRDye 700 Phosphoramidite has been optimized for the 700 nm channel of the LI-COR 4300 DNA Analysis System.	price>
R-C-5527	DSPE-Se-Se-PEG-ADA	The presence of diselenide bonds in DSPE-Se-Se-PEG-ADA allows for its redox-responsive behavior. Under specific conditions,such as the presence of high levels of reducing agents,the diselenide bonds can be cleaved, leading to the release of the ADA enzyme from the liposomes.This property can be exploited to trigger the controlled release or activation of ADA in the targeted cells or tissues.	price>
R-M2-9545	Cholesterol-PEG2000-RVG29PPP(D-RVG29)	Cholesterol-PEG2000-RVG29PPP(D-RVG29) represents a promising strategy for targeted therapeutics, primarily in neurological contexts.The conjugate can encapsulate and deliver various therapeutic agents (small molecules, peptides, nucleic acids) directly to neuronal tissues. Given the ability of RVG29 to cross the blood-brain barrier, this conjugate could be used to treat neurodegenerative diseases (like Alzheimer’s or Parkinson’s disease) or CNS tumors.Can potentially be utilized to deliver genetic materials (such as siRNA or plasmids) into neural cells to address genetic disorders or modulate gene expression.Potential applications in neuroimaging or as a vector for imaging agents to enhance the detection of CNS disorders.	price>
R-M-7015	IRDye® 800 Phosphoramidite,cas:211380-08-4	IRDye 800 Phosphoramidite has been optimized for the 800 nm channel of the LI-COR 4300 DNA Analysis System.	price>
R-C-5528	Ytterbium 99.9% metals basis CAS：7440-64-4	Ytterbium (Yb) with a purity of 99.9% on a metals basis refers to a highly purified form of the element ytterbium. Ytterbium is a rare earth metal belonging to the lanthanide series of elements on the periodic table.	price>
R-M2-9546	DMG-PEG2000-RVG29PPP(D-RVG29)	The DMG-PEG2000-RVG29PPP(D-RVG29) construct represents a sophisticated approach to enhance drug delivery systems, particularly for targeting the central nervous system. The integration of DMG with PEG and RVG29 allows for improved solubility and specific targeting abilities, making this construct suitable for a wide range of therapeutic applications in CNS disorders. Potential use in imaging techniques for neurological conditions, acting as a vector for radiolabeled compounds or contrast agents to enhance visualization in medical imaging.	price>

103210331034103510361037 10381039104010411042