Home > Keywords > 
Catalog name Description price
R-M2-9544 DMG-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG DMG-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG is a versatile molecule potentially applicable in various scientific and medical fields.It could be utilized for effective drug delivery, targeted therapy, or research into cell biology and interactions. price>
R-M-7014 IRDye® 700 Phosphoramidite,cas:648882-22-8 IRDye 700 Phosphoramidite has been optimized for the 700 nm channel of the LI-COR 4300 DNA Analysis System. price>
R-C-5527 DSPE-Se-Se-PEG-ADA The presence of diselenide bonds in DSPE-Se-Se-PEG-ADA allows for its redox-responsive behavior. Under specific conditions,such as the presence of high levels of reducing agents,the diselenide bonds can be cleaved, leading to the release of the ADA enzyme from the liposomes.This property can be exploited to trigger the controlled release or activation of ADA in the targeted cells or tissues. price>
R-M2-9545 Cholesterol-PEG2000-RVG29PPP(D-RVG29) Cholesterol-PEG2000-RVG29PPP(D-RVG29) represents a promising strategy for targeted therapeutics, primarily in neurological contexts.The conjugate can encapsulate and deliver various therapeutic agents (small molecules, peptides, nucleic acids) directly to neuronal tissues. Given the ability of RVG29 to cross the blood-brain barrier, this conjugate could be used to treat neurodegenerative diseases (like Alzheimer’s or Parkinson’s disease) or CNS tumors.Can potentially be utilized to deliver genetic materials (such as siRNA or plasmids) into neural cells to address genetic disorders or modulate gene expression.Potential applications in neuroimaging or as a vector for imaging agents to enhance the detection of CNS disorders. price>
R-M-7015 IRDye® 800 Phosphoramidite,cas:211380-08-4 IRDye 800 Phosphoramidite has been optimized for the 800 nm channel of the LI-COR 4300 DNA Analysis System. price>
R-C-5528 Ytterbium 99.9% metals basis CAS:7440-64-4 Ytterbium (Yb) with a purity of 99.9% on a metals basis refers to a highly purified form of the element ytterbium. Ytterbium is a rare earth metal belonging to the lanthanide series of elements on the periodic table. price>
R-M2-9546 DMG-PEG2000-RVG29PPP(D-RVG29) The DMG-PEG2000-RVG29PPP(D-RVG29) construct represents a sophisticated approach to enhance drug delivery systems, particularly for targeting the central nervous system. The integration of DMG with PEG and RVG29 allows for improved solubility and specific targeting abilities, making this construct suitable for a wide range of therapeutic applications in CNS disorders. Potential use in imaging techniques for neurological conditions, acting as a vector for radiolabeled compounds or contrast agents to enhance visualization in medical imaging. price>
R-C-5529 18:1 PDP PE CAS:474944-13-3 DOPE-SPDP DOPE stands for 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine. It is a phospholipid commonly found in liposomes or lipid nanoparticles used for drug delivery. DOPE provides stability and fluidity to the lipid bilayer, facilitating the encapsulation and delivery of therapeutic agents.SPDP stands for N-succinimidyl 3-(2-pyridyldithio) propionate. It is a bifunctional cross-linking reagent used to link molecules together in bioconjugation reactions. price>
R-M2-9547 Cholesterol-PEG-CD38(ARGDYYGSNSLDYW) The Cholesterol-PEG-CD38(ARGDYYGSNSLDYW) construct represents a sophisticated approach for drug delivery, combining the cellular targeting capabilities of a peptide with the solubility-enhancing properties of PEG and the membrane fusion properties of cholesterol. Its design allows for specific applications in therapeutic and diagnostic fields, primarily within oncology and immunology.Cholesterol-PEG-CD38(ARGDYYGSNSLDYW)could be employed to deliver chemotherapeutic agents specifically to tumor cells expressing CD38, allowing for localized therapy with reduced systemic toxicity.It can be used in the formulation of vaccines where targeting immune cells is necessary to enhance vaccine efficacy. price>
R-M-7017 1,1- diethyl-2,2- cyanogen iodide,cas:977-96-8 1,1-diethyl-2,2-cyanogen iodide is a functional dye for membrane potential monitoring and cell tracing. price>
R-C-5530 PCL3K-TK-PEG5k-Gal PCL3K-TK-PEG5k-Gal is a complex molecule designed for targeted drug delivery in cancer therapy. It combines a biodegradable polyester (PCL3K) as a structural component, thymidine kinase (TK) as a therapeutic agent, polyethylene glycol (PEG5k) for improved stability and solubility, and galactose (Gal) as a targeting ligand to specifically target cancer cells. This combination enables targeted drug delivery to cancer cells, potentially enhancing the effectiveness of cancer treatment while minimizing side effects on non-cancerous cells. price>
R-M2-9548 DMG-PEG-CD38 DMG-PEG-CD38/DMG-PEG-ARGDYYGSNSLDYW is a multifunctional conjugate that utilizes the benefits of lipid modification, PEGylation, and a targeting peptide sequence to improve the delivery of therapeutic agents. Targeting peptides, in particular, are powerful tools in modern therapeutic strategies, enabling the development of more effective and less toxic treatment options. Further development and optimization of this conjugate could advance its use in targeted drug delivery, diagnostic applications, or therapeutic innovations. price>
R-M-7018 3,3-di-n-pentyloxazole dicarbonylcyanine iodide,cas:53213-92-6 3,3-di-n-pentyloxazole dicarbonylcyanine iodide is a functional dye for membrane potential monitoring and cell tracing. price>
R-C-5531 DOPE-HA DOPE-HA is a conjugation system that combines DOPE with HA to create targeted drug delivery systems. By leveraging the properties of DOPE for lipid-based delivery and HA for specific receptor targeting,it offers potential benefits in cancer therapy and other applications where specific targeting and efficient drug delivery are desired. price>
R-M2-9549 N3-C4-NHS ester,cas478801-48-8 N3-C4-NHS ester,cas478801-48-8 is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It is also a noncleavable ADC linker used in the synthesis of antibody-drug conjugates (ADCs). It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups. price>
R-M-7019 3,3-dipropylthiocarbonyl cyanine iodide,cas53336-12-2 3,3-dipropylthiocarbonyl cyanine iodide is a functional dye for membrane potential monitoring and cell tracing. price>
R-C-5532 Poly-D-lysine hydrobromide Poly-D-lysine hydrobromide, often referred to as PDL, is a synthetic polymer made up of D-lysine monomers. It is a positively charged compound commonly used in cell and tissue culture applications.Due to its biocompatibility, PDL is often incorporated into biodegradable or biocompatible materials to promote cell adhesion and tissue regeneration in tissue engineering or regenerative medicine applications. price>
R-M2-9550 Streptavidin-Mal Streptavidin-Mal is a highly versatile reagent that combines the binding strength of streptavidin with the specificity of maleimide chemistry for thiols. This conjugate has numerous applications in bioconjugation, diagnostics, drug delivery, and research. Due to its useful properties, it plays a crucial role in enhancing specificity and sensitivity in various biological and biomedical research and applications. price>
R-M-7020 3,3-Dihexyloxacarbocyanine iodide,cas53213-82-4 3,3-dihexoxycarbonylcyanine iodide is a functional dye for membrane potential monitoring and cell tracing. price>
R-C-5533 Poly(L-lysine hydrochloride) CAS:26124-78-7 Poly-L-lysine hydrochloride is a positively charged synthetic polyamino acid having one HCl per lysine unit. It is a crystalline solid soluble in water. Poly-L-lysine hydrochloride is a good alternative to poly-L-lysine hydrobromide in applications where biocompatibility is critical. price>