X
Email:
sales@ruixibiotech.com

TIP-39 trifluoroacetate salt,CAS :277302-47-3

H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH trifluoroacetate salt

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1231 0.5mg 265.00
- +
+ Add to cart
R-M-1231 1mg 505.00
- +
+ Add to cart

Product description

Tuberoinfundibular peptide, TIP-39, originally isolated from bovine hypothalamus was found to be a potent and selective agonist of the pTH2 receptor which regulates pituitary hormone secretion and spinal cord regions involved in pain perception. Synthetic TIP-39 activated the human and rat pTH2 receptors with EC₅₀ of 0.5 ± 0.12 nM and 0.8 ± 0.3 nM, respectively. TIP-39 was much more potent than pTH (EC₅₀ = 49 ± 23 nM) at the rat pTH2 receptor. The discovery of TIP-39 provides an important tool for the investigation of the pTH2 receptor functions inside and outside the nervous system.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 277302-47-3
Sequence SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Molecular Formula C₂₀₂H₃₂₅N₆₁O₅₄S
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product