TIP-39 trifluoroacetate salt,CAS :277302-47-3
H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1231 | 0.5mg | 265.00 | + Add to cart |
|
R-M-1231 | 1mg | 505.00 | + Add to cart |
|
|
Product description
Tuberoinfundibular peptide, TIP-39, originally isolated from bovine hypothalamus was found to be a potent and selective agonist of the pTH2 receptor which regulates pituitary hormone secretion and spinal cord regions involved in pain perception. Synthetic TIP-39 activated the human and rat pTH2 receptors with EC₅₀ of 0.5 ± 0.12 nM and 0.8 ± 0.3 nM, respectively. TIP-39 was much more potent than pTH (EC₅₀ = 49 ± 23 nM) at the rat pTH2 receptor. The discovery of TIP-39 provides an important tool for the investigation of the pTH2 receptor functions inside and outside the nervous system.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 277302-47-3 |
Sequence | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
Molecular Formula | C₂₀₂H₃₂₅N₆₁O₅₄S |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product