Tau Peptide (306-336) (Repeat 3 Domain) trifluoroacetate salt,CAS :330456-26-3

H-Val-Gln-Ile-Val-Tyr-Lys-Pro-Val-Asp-Leu-Ser-Lys-Val-Thr-Ser-Lys-Cys-Gly-Ser-Leu-Gly-Asn-Ile-His-His-Lys-Pro-Gly-Gly-Gly-Gln-OH trifluoroacetate salt

Product description

The amphipathic helical structure of the third fragment (306-336) in the four-repeat microtubule-binding domain of the water-soluble tau protein could be responsible for the formation of the neuropathological filament.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	330456-26-3
Sequence	VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
Molecular Formula	C₁₄₃H₂₃₆N₄₂O₄₂S
Storage	-20℃,protected from light and moisture
Transportation	4-25℃ temperature for up to 2 weeks
Stability	1 year

Document

msds of Tau Peptide (306-336) (Repeat 3 Domain) trifluoroacetate salt

Related Product

• tau-peptide-307-321-trifluoroacetate-salt