Tamra-BNP (1-32), human,CAS:114471-18-0
Tamra-BNP (1-32), human 
						
						Product description
							Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).
| Appearance | N/A | 
|---|---|
| Molecular weight | N/A | 
| Purity | >90% | 
| Solubility | N/A | 
| Cas | 114471-18-0 | 
| Sequence | TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) (Cys10 and 26 bridge) | 
| One letter sequence | TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge) | 
| Molecular formula | C168H266N52O46S4 | 
| Storage | -20℃,protected from light and moisture | 
| Transportation | 4-25℃ temperature for up to 2 weeks | 
| Stability | 1 year | 
Document
							Related Product
							
						
Items-$0.00

Email:
Tel.:
msds      of     Tamra-BNP (1-32), human 
                    RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
                
                    Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China 
                
                    Tel:  02988811435
                
                    Fax: (86-29)8881-1435
                
                    Email: sales@ruixibiotech.com
                
                    Web: http://www.ruixibiotech.com    
					
							
                

