X
Email:
sales@ruixibiotech.com

Tamra-BNP (1-32), human,CAS:114471-18-0

Tamra-BNP (1-32), human

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1696 1mg 350.00
- +
+ Add to cart

Product description

Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 114471-18-0
Sequence TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) (Cys10 and 26 bridge)
One letter sequence TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)
Molecular formula C168H266N52O46S4
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product