Stresscopin (human),CAS: 352020-03-2
H-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH₂
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1184 | 0.5mg | 548.00 | + Add to cart |
|
R-M-1184 | 1mg | 915.00 | + Add to cart |
|
|
Product description
Stresscopin is a specific ligand for the corticotropin-releasing hormone receptor type 2 (CRHR2). Transcripts are expressed in brain and most tissues analyzed. Intraperitoneal injections of stresscopin suppresses heat-induced edema formation in anesthetized rats. It also decreases food intake and exhibits an inhibitory effect on gastric emptying activity. This CRHR2 agonist might represent an endogenous ligand for maintaining homeostasis after stress.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 352020-03-2 |
Sequence | TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH₂ |
Synonyms | SCP (human) |
Molecular Formula | C₁₉₅H₃₂₆N₅₆O₅₃S₂ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product