Home > products > peptide
> synthetic-peptide
> stichodactyla-helianthus-neurotoxin-shk-trifluoroacetate-salt
Stichodactyla helianthus Neurotoxin (ShK) trifluoroacetate salt,CAS: 172450-46-3
Arg-Ser-Cys-Ile-Asp-Thr-Ile-Pro-Lys-Ser-Arg-Cys-Thr-Ala-Phe-Gln-Cys-Lys-His-Ser-Met-Lys-Tyr-Arg-Leu-Ser-Phe-Cys-Arg-Lys-Thr-Cys-Gly-Thr-Cys
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1182 | 0.1mg | 200.00 | + Add to cart |
|
R-M-1182 | 0.5mg | 900.00 | + Add to cart |
|
R-M-1182 | 1mg | 1390.00 | + Add to cart |
|
|
Product description
ShK-toxin, originally isolated from the sea anemone Stichodactyla helianthus, has been found to inhibit the specific binding of dendrotoxin I to rat brain membranes. Due to its unique structure (it contains three intramolecular disulfide bridges) and high affinity for some potassium channels, ShK-toxin may become a useful molecular probe for investigating potassium channels.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 172450-46-3 |
Sequence | RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC |
Synonyms | ShK |
Molecular Formula | C₁₆₉H₂₇₄N₅₄O₄₈S₇ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product