X
Email:
sales@ruixibiotech.com

Sphistin Synthetic Peptide

Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide)

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-5080 5mg 605.00
- +
+ Add to cart
R-M-5080 10mg 1000.00
- +
+ Add to cart

Product description

Sphistin Synthetic Peptide is a truncated fragments of Sphistin Synthetic Peptide that shows potent antimicrobial activity.Sphistin is a synthetic 38-amino acid H2A derived peptide.


Appearance N/A
Molecular Weight N/A
Purity >90%
Solubility N/A
Molecular formula C159H250N50O37S
Sequences KAKAKAVSRSARAGL QFPVGRIHRHLK/Lys-Ala-Lys-Ala-Lys-Ala-Val-Ser-Arg-Ser-Ala-Arg-Ala-Gly-Leu-Gln-Phe-Pro-Val-Gly-Arg-Ile-His-Arg-His-Leu-Lys / FITC-KAKAKAVSRSARAGLQFPVGRIHRHLK
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 10 mg/ml
Document

Related Product