Sphistin Synthetic Peptide
Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide)
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-5080 | 5mg | 605.00 | + Add to cart |
|
R-M-5080 | 10mg | 1000.00 | + Add to cart |
|
|
Product description
Sphistin Synthetic Peptide is a truncated fragments of Sphistin Synthetic Peptide that shows potent antimicrobial activity.Sphistin is a synthetic 38-amino acid H2A derived peptide.
Appearance | N/A |
---|---|
Molecular Weight | N/A |
Purity | >90% |
Solubility | N/A |
Molecular formula | C159H250N50O37S |
Sequences | KAKAKAVSRSARAGL QFPVGRIHRHLK/Lys-Ala-Lys-Ala-Lys-Ala-Val-Ser-Arg-Ser-Ala-Arg-Ala-Gly-Leu-Gln-Phe-Pro-Val-Gly-Arg-Ile-His-Arg-His-Leu-Lys / FITC-KAKAKAVSRSARAGLQFPVGRIHRHLK |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 10 mg/ml |
Document
Related Product