Secretoneurin (mouse, rat) trifluoroacetate salt ,CAS:149146-12-3
H-Thr-Asn-Glu-Ile-Val-Glu-Glu-Gln-Tyr-Thr-Pro-Gln-Ser-Leu-Ala-Thr-Leu-Glu-Ser-Val-Phe-Gln-Glu-Leu-Gly-Lys-Leu-Thr-Gly-Pro-Ser-Asn-Gln-OH trifluoroacetate salt
Product description
Secretogranin II (154-186) is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II (chromogranin C). It enhances dopamine release in a concentration-dependent manner. A role in neuro-immunological processes has been proposed due to its capability to act as chemoattractant for eosinophils and monocytes.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 149146-12-3 |
Sequence | TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ |
Synonyms | Secretogranin II (154-186) (mouse, rat) |
Molecular Formula | C₁₅₉H₂₅₂N₄₀O₅₈ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product