RVG-9R trifluoroacetate salt,CAS:1678417-57-6

H-Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-1148	0.5mg	265.00	- +	+ Add to cart
R-M-1148	1mg	450.00	- +	+ Add to cart

Product description

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	1678417-57-6
Sequence	YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Synonyms	Rabies Virus Glycoprotein (194-221) Nonaarginine Chimer, Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)
Molecular Formula	C₂₀₁H₃₃₄N₈₂O₅₅S₂
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document

msds of RVG-9R trifluoroacetate salt