rec IGF-II (1-67) (human)

rec IGF-II (1-67) (human)

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-878 50ug 265.00
- +
+ Add to cart

Product description

rec IGF-II (1-67) (human),CAS: 96081-16-2 from ruixi.approx. ED₅₀ = 0.1 ng/mL IGF-II seems to be specifically involved in fetal growth, but otherwise shows similar biological activities to IGF-I.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 96081-16-2
Sequence AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Molecular Formula C₃₂₁H₄₉₉N₉₃O₁₀₁S₆
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product