pTH (1-34) (human) acetate salt,CAS:52232-67-4
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH acetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1145 | 15mg | 990.00 | + Add to cart |
|
R-M-1145 | 35mg | 1890.00 | + Add to cart |
|
|
Product description
Teriparatide, which consists of the N-terminal 34 amino acid residues of parathyroid hormone, shows the same potency and pharmacological profile as the native hormone. Administration of teriparatide stimulates bone formation and increases the bone mineral density (BMD).
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 52232-67-4 |
Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
Synonyms | Parathyroid Hormone (1-34), human, Teriparatide |
Molecular Formula | C₁₈₁H₂₉₁N₅₅O₅₁S₂ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product