pTH (1-31) amide (human),CAS:173833-08-4
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-NH₂
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1143 | 0.5mg | 265.00 | + Add to cart |
|
R-M-1143 | 1mg | 505.00 | + Add to cart |
|
|
Product description
pTH (1-31) amide appears so far to be the smallest of the potently osteogenic pTH fragments. The osteogenic activity of this pTH fragment seems to be related to its ability to activate adenylyl cyclase. Unlike pTH, this fragment does not activate phospholipase C and should therefore have fewer side-effects and find application in the osteoporosis treatment.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 173833-08-4 |
Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV-NH₂ |
Molecular Formula | C₁₆₂H₂₇₀N₅₀O₄₆S₂ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product