Preptin (rat) trifluoroacetate salt,CAS : 315197-73-0
H-Asp-Val-Ser-Thr-Ser-Gln-Ala-Val-Leu-Pro-Asp-Asp-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Lys-Phe-Asp-Thr-Trp-Arg-Gln-Ser-Ala-Gly-Arg-Leu-OH trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-180 | 0.5mg | 300.00 | + Add to cart |
|
R-M-180 | 1mg | 615.00 | + Add to cart |
|
|
Product description
Preptin is a 34-amino acid peptide hormone, which is co-secreted with insulin from the pancreatic β-cells in response to glucose stimulation. It is osteogenic in vitro and in vivo and may act in concert with the other β-cell hormones insulin and amylin to stimulate bone formation in hyperinsulinemic states such as obesity.
Appearance | Powder |
---|---|
Molecular weight | N/A |
CAS | 315197-73-0 |
Solubility | DMSO |
One Letter Code | DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL |
Application | Diabetes,Regenerative Medicine |
Purity | >95% |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product