Prepro-Atrial Natriuretic Factor (26-55) (human),CAS:112160-82-4
H-Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp-OH
Product description
Prepro-atrial natriuretic factor (26-55) (human) (NT-pro-ANP (1-30)) is one of four peptide hormones derived from the atrial natriuretic prohormone. It is also known as long acting natriuretic peptide. The peptide has potent vasodilatory properties equal to atrial natriuretic factor.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 112160-82-4 |
Sequence | NPMYNAVSNADLMDFKNLLDHLEEKMPLED |
Synonyms | NT-pro-ANP (human) (1-30), Prepro-hANF (26-55) Cardiodilatin-Related Peptide (human), Prepro-ANF (26-55), human |
Molecular Formula | C₁₅₂H₂₃₆N₃₈O₅₁S₃ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product