opeptide W-30 (rat),CAS :383415-90-5
opeptide W-30 (rat)
Product description
This peptide was recently identified as the endogenous ligand for the two structurally related orphan G-protein-coupled receptors (GPCRs) GPR7 and GPR8 which are expressed in the central nervous system. NPW-30 activated and bound to both GPR7 and GPR8 at similar effective doses. Intracerebroventricular administration of NPW in rats resulted in an increased food intake and stimulation of prolactin release indicating that NPW acts as a mediator of the central control of feeding and the neuroendocrine system.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 383415-90-5 |
Sequence | H-Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ser-Gly-Leu-Leu-Met-Gly-Leu-Arg-Arg-Ser-Pro-Tyr-Leu-Trp -OH (trifluoroacetate salt) |
One letter sequence | WYKHVASPRYHTVGRASGLLMGLRRSPYLW |
Molecular formula | C165H249N49O38S1 |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product