Neuropeptide Y (free acid) (human, rat) trifluoroacetate salt,CAS :99575-89-0

H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-OH trifluoroacetate salt

Product description

Neuropeptide Y (free acid) (human, rat) trifluoroacetate salt,CAS :99575-89-0 from ruixi.Desamidation of neuropeptide Y suppresses almost all of NPY effects.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	99575-89-0
Sequence	YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Synonyms	NPY (free acid) (human, rat)
Molecular Formula	C₁₈₉H₂₈₄N₅₄O₅₈S
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document

msds of Neuropeptide Y (free acid) (human, rat) trifluoroacetate salt

Related Product

• neuropeptide-y-human-rat-trifluoroacetate-salt