Neuropeptide K (human, porcine, rat) trifluoroacetate salt,CAS:96827-05-3

H-Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu-Tyr-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH₂ trifluoroacetate salt

Product description

The brain tachykinin NPK is also a major tachykinin in plasma and tumor tissues of carcinoid patients.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	96827-05-3
Sequence	DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM -NH₂
Synonyms	Neuropeptide K, porcine
Molecular Formula	C₁₇₅H₂₈₄N₅₂O₅₂S
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document

msds of Neuropeptide K (human, porcine, rat) trifluoroacetate salt

Related Product

• neuropeptide-s-human-trifluoroacetate-salt