Melanostatin Peptide (Frog)

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-1295	1mg	300.00	- +	+ Add to cart

Product description

Melanostatin Peptide (Frog) is implicated in the control of feeding and the secretion of gonadotrophin-release hormone.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Synonyms	Neuropeptide Y; NPY; Melanostatin; Melanostatin release-inhibiting factor
Sequence	Frog: H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Lys-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 or H-YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY-NH2
Molecular Formula	C189H285N53O57S1
Storage	-20℃,protected from light and moisture
Transportation	4-25℃ temperature for up to 2 weeks
Stability	1 year

Document

msds of Melanostatin Peptide (Frog)