Margatoxin (MgTX),CAS : 145808-47-5
Margatoxin
Product description
Margatoxin (MgTX), originally isolated from the venom of the scorpion Centruroides margaritatus, is a peptidyl inhibitor of voltage dependent K⁺ channels in brain synaptic plasma membranes. MgTX blocks the n-type current of human T-lymphocytes (IC₅₀ = 50 pM, 20 fold more potent than charybdotoxin), has a lower dissociation rate and has no effect on Ca²⁺ activated channels. MgTX is therefore a useful tool to study the physiologic role of K⁺ channels.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 145808-47-5 |
Sequence | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH |
Molecular Formula | C₁₇₈H₂₈₆N₅₂O₅₀S₇ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product