Lepirudin acetate salt,CAS: 138068-37-8
Lepirudin acetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-934 | 1mg | 1300.00 | + Add to cart |
|
R-M-934 | 5mg | 5500.00 | + Add to cart |
|
|
Product description
Lepirudin is an anticoagulant which functions as a direct thrombin inhibitor.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 138068-37-8 |
Sequence | LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ |
Synonyms | (Leu¹,Thr²)-Hirudin (desulfated) |
Molecular Formula | C₂₈₇H₄₄₀N₈₀O₁₁₁S₆ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product