Intermedin (rat) trifluoroacetate salt,CAS:1816940-00-7
Intermedin (rat) trifluoroacetate salt
Product description
Intermedin (rat) trifluoroacetate salt,CAS:1816940-00-7 from ruixi.It can be used in the research of cardiovascular system & diseases and gastrointestinal.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 1816940-00-7 |
Sequence | PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH₂ |
Synonyms | IMD (rat), rIMD, Adrenomedullin-2 (rat), ADM2 (rat) |
Molecular Formula | C₂₂₆H₃₆₁N₇₅O₆₄S₂ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product