GRF (rat) trifluoroacetate salt

H-His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Arg-Ser-Arg-Phe-Asn-OH trifluoroacetate salt

Product description

GRF (rat) trifluoroacetate salt,CAS :86472-71-1 from ruixi..It is a synthetic peptide, only used for scientific research, not for human body.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	86472-71-1
Sequence	HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN
Molecular Formula	C₂₂₅H₃₆₁N₇₇O₆₆S
Storage	-20℃,protected from light and moisture
Transportation	4-25℃ temperature for up to 2 weeks
Stability	1 year

Document

msds of GRF (rat) trifluoroacetate salt

Related Product

• guanylin-mouse-rat