GRF (human) acetate salt

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-777	1mg	275.00	- +	+ Add to cart
R-M-777	5mg	1115.00	- +	+ Add to cart

Product description

GRF is the hypothalamic peptide hormone that specifically stimulates synthesis and release of the growth hormone by somatotropic cells of the anterior pituitary gland.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	83930-13-6
Sequence	YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂
Synonyms	Somatorelin, GHRH (human), Growth Hormone-Releasing Factor (human), Growth Hormone-Releasing Hormone (human), GHRF (1-44), human, Somatocrinin (human), Somatoliberin (human)
Molecular Formula	C₂₁₅H₃₅₈N₇₂O₆₆S
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document

msds of GRF (human) acetate salt