GRF (1-29) amide (human) acetate salt
H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ acetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-775 | 1mg | 180.00 | + Add to cart |
|
R-M-775 | 5mg | 740.00 | + Add to cart |
|
|
Product description
GRF (1-29) amide (sermorelin) is the shortest GRF fragment with full biological activity.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 86168-78-7 |
Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ |
Synonyms | Sermorelin |
Molecular Formula | C₁₄₉H₂₄₆N₄₄O₄₂S |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product