(Glu¹³·¹⁷·²⁰)-Osteocalcin (1-46) (mouse) trifluoroacetate salt,CAS :1802086-27-6

H-Tyr-Leu-Gly-Ala-Ser-Val-Pro-Ser-Pro-Asp-Pro-Leu-Glu-Pro-Thr-Arg-Glu-Gln-Cys-Glu-Leu-Asn-Pro-Ala-Cys-Asp-Glu-Leu-Ser-Asp-Gln-Tyr-Gly-Leu-Lys-Thr-Ala-Tyr-Lys-Arg-Ile-Tyr-Gly-Ile-Thr-Ile-OH trifluoroacetate salt (Disulfide bond)

Product description

Non-carboxylated osteocalcin was shown to be a bone-specific hormone involved in the regulation of glucose metabolism, for which the Gla peptide acts as precursor and transport form.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	1802086-27-6
Sequence	YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI
Molecular Formula	C₂₂₆H₃₅₁N₅₇O₇₄S₂
Storage	-20℃,protected from light and moisture
Transportation	4-25℃ temperature for up to 2 weeks
Stability	1 year

Document

msds of (Glu¹³·¹⁷·²⁰)-Osteocalcin (1-46) (mouse) trifluoroacetate salt

Related Product

• dota-tris-tbu-ester