X
Email:
sales@ruixibiotech.com

Fibronectin-Binding Protein Peptide,Cas:119977-20-7

Fibronectin-Binding Protein Peptide

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1368 1mg 230.00
- +
+ Add to cart

Product description

The fibronectin-binding protein A promotes bacterial attachment to multiple substrates, such as fibronectin, fibrinogen, elastin peptides and tropoelastin, confering to Staphylococcus aureus the ability to invade endothelial cells. The peptide also promotes adherence to and aggregation of activated platelets.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 119977-20-7
Synonyms Fibronectin-binding protein A; fnbA
Sequence H-Phe-Asn-Lys-His-Thr-Glu-Ile-Ile-Glu-Glu-Asp-Thr-Asn-Lys-Asp-Lys-Pro-Ser-Tyr-Gln-Phe-Gly-Gly-His-Asn-Ser-Val-Asp-Phe-Glu-Glu-Asp-Thr-Leu-Pro-Lys-Val-OH or H-FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV-OH
Molecular Formula  C190H283N49O66
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product