X
Email:
sales@ruixibiotech.com

Endotrophin (mouse) trifluoroacetate salt,CAS:1678414-54-4

Endotrophin (mouse) trifluoroacetate salt

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-823 1mg 1699.00
- +
+ Add to cart

Product description

Endotrophin is a carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 1678414-54-4
Sequence TEPLFLTKTDICKLSRDAGTCVDFKLLWHYDLESKSCKRFWYGGCGGNENRFHSQEECEKMCSPELTV
Molecular Formula C₃₄₅H₅₂₀N₉₂O₁₀₆S₇
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product