ELA-32(human) TFA

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-R-0932	5mg	600.00	- +	+ Add to cart
R-R-0932	10mg	950.00	- +	+ Add to cart

Product description

ELA-32(human) TFA is a potent, high affinity apelin receptor agonist (IC50=0.27 nM; Kd=0.51 nM). ELA-32(human) TFA exhibits no binding GPR15 and GPR25. ELA-32(human) TFA activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. ELA-32(human) TFA also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. ELA-32(human) TFA stimulates angiogenesis in HUVEC cells.

Appearance	N/A
Molecular Weight	4081.84
Purity	>90%
Sequence Shortening	QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP (Disulfide bridge: Cys17-Cys22)
Formula	C172H290F3N63O41S4
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 2 weeks
Stability	1 year

Document

msds of ELA-32(human) TFA