Echistatin TFA

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-R-0946	1mg	850.00	- +	+ Add to cart
R-R-0946	5mg	2200.00	- +	+ Add to cart

Product description

Echistatin TFA, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1.

Appearance	N/A
Molecular Weight	5531.02
Purity	>90%
Sequence Shortening	ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT (Disulfide bridge:Cys2-Cys11;Cys7-Cys32;Cys8-Cys37;Cys20-Cys39)
Formula	C219H342F3N71O76S9
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 2 weeks
Stability	1 year

Document

msds of Echistatin TFA