Echistatin,CAS:154303-05-6
Echistatin
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-685 | 0.1mg | 335.00 | + Add to cart |
|
R-M-685 | 0.5mg | 1370.00 | + Add to cart |
|
|
Product description
Echistatin is a 49-amino acid polypeptide from the venom of the saw-scaled viper, Echis carinatus. The peptide containing an RGD motif binds to the glycoprotein IIb/IIIa receptor on the platelet and is a potent competitive inhibitor of ADPstimulated platelet aggregation mediated by fibrinogen and other factors. Furthermore, echistatin effectively inhibits osteoclastic bone resorption in vitro and in vivo.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >95% |
Solubility | N/A |
Cas | 154303-05-6 |
Sequence | ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT |
Molecular Formula | C₂₁₇H₃₄₁N₇₁O₇₄S₉ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product