Defensin HNP-3 (human),Cas:136661-76-2
Defensin HNP-3 (human)
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1531 | 0.5mg | 550.00 | + Add to cart |
|
R-M-1531 | 1mg | 890.00 | + Add to cart |
|
|
Product description
This peptide contain 6 conserved disulfide-linked cysteines. In vitro, it has a prominent antimicrobial activities against bacteria, fungi, and certain enveloped viruses. In addition, human and rabbit defensins exert potent cytotoxicity in vitro against various mammalian tumor cells.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Sequence | DCYCRIPACIAGERRYGTCIYQGRLWAFCC(Cys2 and Cys30/Cys4 and Cys19/Cys9 and Cys29 Bridge) |
Molecular Formula | C151H222N44O40S6 |
CAS | 136661-76-2 |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product