CRF Peptide (Ovine),Cas:9015-71-8
Corticotropin Releasing Factor Peptide (Ovine)
Product description
Corticotropin releasing factor (CRF), a hormone from the hypothalamus, regulates the release of corticotropin (ACTH) and endorphin from the pituitary gland. CRF is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 9015-71-8 |
Synonyms | Corticotropin-releasing factor; CRF; corticotropin-releasing hormone; CRH; corticoliberin; endorpholiberin |
Sequence | H-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2 or H-SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2 |
Molecular Formula | C205H339N59O63S |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product